Human RHBDD3/C22orf3/HS984G1A ORF/cDNA clone-Lentivirus plasmid (NM_012265)

Cat. No.: pGMLP004150
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RHBDD3/C22orf3/HS984G1A Lentiviral expression plasmid for RHBDD3 lentivirus packaging, RHBDD3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RHBDD3/C22orf3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $625.08
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004150
Gene Name RHBDD3
Accession Number NM_012265
Gene ID 25807
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1161 bp
Gene Alias C22orf3,HS984G1A,PTAG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATGCCAGGGGCCCCCATGGCCAACTGTCCCCAGCACTGCCTCTGGCCTCCTCAGTCCTGATGCTGCTGATGAGCACCCTGTGGCTGGTGGGGGCCGGCCCCGGCCTGGTCCTGGCCCCGGAGCTGTTGCTGGACCCCTGGCAGGTGCACCGGCTGCTGACCCATGCCCTGGGCCACACGGCCCTGCCAGGCCTGCTCCTGAGCCTGCTGCTCCTGCCCACTGTGGGCTGGCAGCAGGAGTGCCACCTGGGCACGCTGAGATTCCTGCATGCCTCAGCCCTGCTCGCCCTGGCTTCTGGGCTGCTGGCAGTGCTGCTGGCAGGCCTTGGGCTGTCCAGTGCAGCCGGCAGCTGTGGATACATGCCTGTCCACCTGGCCATGCTGGCTGGGGAGGGACACCGCCCTAGACGGCCCCGTGGGGCACTGCCACCGTGGCTGTCGCCGTGGCTGCTGCTTGCCCTGACCCCACTGCTCAGCTCTGAGCCACCCTTCCTGCAGCTCCTTTGCGGCCTCCTTGCCGGCCTGGCCTATGCAGCTGGGGCCTTCCGGTGGCTGGAACCCTCAGAGCGACGGCTGCAGGTGCTGCAGGAGGGCGTCTTGTGCAGGACCTTGGCGGGGTGCTGGCCCCTGAGGCTCCTTGCCACCCCGGGTAGCCTGGCGGAGCTGCCTGTCACCCATCCTGCCGGAGTGAGGCCTCCCATCCCTGGACCGCCTTATGTGGCCTCCCCTGACCTCTGGTCCCACTGGGAAGACTCAGCCCTGCCCCCACCAAGCCTGAGGCCTGTGCAGCCCACCTGGGAGGGCTCCTCAGAGGCAGGCCTGGACTGGGCTGGGGCCAGCTTCTCCCCAGGGACTCCGATGTGGGCGGCCTTGGATGAGCAGATGCTGCAGGAGGGCATCCAGGCCTCGCTTCTTGACGGGCCAGCCCAGGAACCCCAGAGCGCACCATGGCTGTCCAAGTCCTCTGTCTCCTCTCTGCGGCTGCAGCAGCTGGAGCGCATGGGCTTCCCTACGGAGCAGGCGGTGGTGGCACTGGCAGCCACAGGCCGTGTGGAGGGTGCCGTGTCACTGTTGGTTGGAGGACAAGTGGGCACTGAGACCCTGGTGACCCATGGAAAGGGTGGGCCTGCCCACTCCGAGGGTCCTGGGCCTCCCTAG
ORF Protein Sequence MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGHTALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCGYMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAAGAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1491-Ab Anti-RHBDD3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1491-Ag RHBDD3 protein
    ORF Viral Vector pGMLP004150 Human RHBDD3 Lentivirus plasmid
    ORF Viral Vector vGMLP004150 Human RHBDD3 Lentivirus particle


    Target information

    Target ID GM-IP1491
    Target Name RHBDD3
    Gene ID 25807, 279766, 714479, 289753, 101093148, 486341, 507674, 100059128
    Gene Symbol and Synonyms C22orf3,HS984G1A,PTAG,RGD1311827,RHBDD3
    Uniprot Accession Q9Y3P4
    Uniprot Entry Name RHBD3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000100263
    Target Classification Not Available

    Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to act upstream of or within several processes, including liver development; negative regulation of natural killer cell activation; and positive regulation of protein catabolic process. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.