Human CCDC134 ORF/cDNA clone-Lentivirus plasmid (NM_024821)

Cat. No.: pGMLP004283
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCDC134/ Lentiviral expression plasmid for CCDC134 lentivirus packaging, CCDC134 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCDC134/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $472.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004283
Gene Name CCDC134
Accession Number NM_024821
Gene ID 79879
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 690 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCTTCTTCAATTCCTGGCCTTCCTCTTTGTCCTGCTTTTGTCTGGGATGGGAGCCACAGGCACCTTGAGGACCTCCCTGGACCCAAGCCTGGAGATCTACAAGAAGATGTTTGAGGTGAAGCGGCGGGAGCAGCTGTTGGCACTGAAGAACCTGGCACAGCTGAACGACATCCACCAGCAGTACAAGATCCTTGATGTCATGCTCAAGGGGCTCTTTAAGGTGCTGGAGGACTCCCGGACAGTGCTCACCGCTGCTGATGTGCTCCCAGATGGGCCCTTCCCCCAGGACGAGAAGCTGAAGGATGCTTTCTCCCACGTGGTGGAGAACACGGCCTTCTTCGGCGATGTGGTGCTGCGCTTCCCGAGGATTGTGCACTATTACTTTGACCACAACTCCAACTGGAACCTCCTCATCCGCTGGGGTATCAGTTTCTGCAACCAGACAGGCGTCTTCAACCAGGGGCCCCACTCGCCCATCCTCAGCCTGATGGCCCAGGAGCTGGGGATCAGTGAGAAAGACTCCAACTTCCAGAACCCATTTAAAATCGACCGCACAGAGTTCATTCCCAGCACTGACCCTTTCCAGAAGGCCCTGAGAGAAGAAGAGAAACGCCGAAAGAAAGAGGAGAAGCGGAAGGAGATCCGAAAAGGCCCAAGGATCTCCAGATCCCAGTCTGAGTTATAG
ORF Protein Sequence MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0735-Ab Anti-CC134/ CCDC134 functional antibody
    Target Antigen GM-Tg-g-SE0735-Ag CCDC134 protein
    ORF Viral Vector pGMLP004283 Human CCDC134 Lentivirus plasmid
    ORF Viral Vector vGMLP004283 Human CCDC134 Lentivirus particle


    Target information

    Target ID GM-SE0735
    Target Name CCDC134
    Gene ID 79879, 76457, 708713, 500909, 101082250, 516012, 100055970
    Gene Symbol and Synonyms 2310042L06Rik,CCDC134,OI22
    Uniprot Accession Q9H6E4
    Uniprot Entry Name CC134_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000100147
    Target Classification Not Available

    Predicted to act upstream of or within angiogenesis and animal organ development. Located in membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.