Human CALCB/CALC2/CGRP-II ORF/cDNA clone-Lentivirus plasmid (NM_000728)
Cat. No.: pGMLP004385
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CALCB/CALC2/CGRP-II Lentiviral expression plasmid for CALCB lentivirus packaging, CALCB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CALCB/CALC2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004385 |
Gene Name | CALCB |
Accession Number | NM_000728 |
Gene ID | 797 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 384 bp |
Gene Alias | CALC2,CGRP-II,CGRP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGTTTCCGGAAGTTCTCCCCCTTCCTGGCTCTCAGTATCTTGGTCCTGTACCAGGCGGGCAGCCTCCAGGCGGCGCCATTCAGGTCTGCCCTGGAGAGCAGCCCAGACCCGGCCACACTCAGTAAAGAGGACGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAGATGAAGGCCAGTGAGCTGAAGCAGGAGCAGGAGACACAGGGCTCCAGCTCCGCTGCCCAGAAGAGAGCCTGCAACACTGCCACCTGTGTGACTCATCGGCTGGCAGGCTTGCTGAGCAGATCAGGGGGCATGGTGAAGAGCAACTTCGTGCCCACCAATGTGGGTTCCAAAGCCTTTGGCAGGCGCCGCAGGGACCTTCAAGCCTGA |
ORF Protein Sequence | MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-228 | Pre-Made Galcanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody |
Biosimilar | GMP-Bios-ab-191 | Pre-Made Eptinezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody |
Biosimilar | GMP-Bios-ab-222 | Pre-Made Fremanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody |
Target Antibody | GM-Tg-g-T09067-Ab | Anti-CALCB/ CALC2/ CGRP-II functional antibody |
Target Antigen | GM-Tg-g-T09067-Ag | CALCB protein |
ORF Viral Vector | pGMLP004385 | Human CALCB Lentivirus plasmid |
ORF Viral Vector | vGMLP004385 | Human CALCB Lentivirus particle |
Target information
Target ID | GM-T09067 |
Target Name | CALCB |
Gene ID | 797, 698209, 101094539, 514876 |
Gene Symbol and Synonyms | CALC2,CALCA,CALCB,CGRP-II,CGRP2,CT |
Uniprot Accession | P10092 |
Uniprot Entry Name | CALCB_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index |
Disease | Not Available |
Gene Ensembl | ENSG00000175868 |
Target Classification | Not Available |
Predicted to enable calcitonin receptor binding activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region. Predicted to be active in extracellular space. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.