Human CALCB/CALC2/CGRP-II ORF/cDNA clone-Lentivirus plasmid (NM_000728)

Cat. No.: pGMLP004385
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CALCB/CALC2/CGRP-II Lentiviral expression plasmid for CALCB lentivirus packaging, CALCB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CALCB/CALC2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004385
Gene Name CALCB
Accession Number NM_000728
Gene ID 797
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 384 bp
Gene Alias CALC2,CGRP-II,CGRP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTTTCCGGAAGTTCTCCCCCTTCCTGGCTCTCAGTATCTTGGTCCTGTACCAGGCGGGCAGCCTCCAGGCGGCGCCATTCAGGTCTGCCCTGGAGAGCAGCCCAGACCCGGCCACACTCAGTAAAGAGGACGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAGATGAAGGCCAGTGAGCTGAAGCAGGAGCAGGAGACACAGGGCTCCAGCTCCGCTGCCCAGAAGAGAGCCTGCAACACTGCCACCTGTGTGACTCATCGGCTGGCAGGCTTGCTGAGCAGATCAGGGGGCATGGTGAAGAGCAACTTCGTGCCCACCAATGTGGGTTCCAAAGCCTTTGGCAGGCGCCGCAGGGACCTTCAAGCCTGA
ORF Protein Sequence MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-228 Pre-Made Galcanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Biosimilar GMP-Bios-ab-191 Pre-Made Eptinezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Biosimilar GMP-Bios-ab-222 Pre-Made Fremanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Target Antibody GM-Tg-g-T09067-Ab Anti-CALCB/ CALC2/ CGRP-II functional antibody
    Target Antigen GM-Tg-g-T09067-Ag CALCB protein
    ORF Viral Vector pGMLP004385 Human CALCB Lentivirus plasmid
    ORF Viral Vector vGMLP004385 Human CALCB Lentivirus particle


    Target information

    Target ID GM-T09067
    Target Name CALCB
    Gene ID 797, 698209, 101094539, 514876
    Gene Symbol and Synonyms CALC2,CALCA,CALCB,CGRP-II,CGRP2,CT
    Uniprot Accession P10092
    Uniprot Entry Name CALCB_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Not Available
    Gene Ensembl ENSG00000175868
    Target Classification Not Available

    Predicted to enable calcitonin receptor binding activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region. Predicted to be active in extracellular space. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.