Human S100G/CABP/CABP1 ORF/cDNA clone-Lentivirus plasmid (NM_004057)

Cat. No.: pGMLP004518
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100G/CABP/CABP1 Lentiviral expression plasmid for S100G lentivirus packaging, S100G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to S100G/CABP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004518
Gene Name S100G
Accession Number NM_004057
Gene ID 795
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 240 bp
Gene Alias CABP,CABP1,CABP9K,CALB3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTACTAAAAAGTCTCCTGAGGAACTGAAGAGGATTTTTGAAAAATATGCAGCCAAAGAAGGTGATCCAGACCAGTTGTCAAAGGATGAACTGAAGCTATTGATTCAGGCTGAATTCCCCAGTTTACTCAAAGGTCCAAACACCCTAGATGATCTCTTTCAAGAACTGGACAAGAATGGAGATGGAGAAGTTAGTTTTGAAGAATTCCAAGTATTAGTAAAAAAGATATCCCAGTGA
ORF Protein Sequence MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06819-Ab Anti-S100G monoclonal antibody
    Target Antigen GM-Tg-g-T06819-Ag S100G protein
    ORF Viral Vector pGMLP004518 Human S100G Lentivirus plasmid
    ORF Viral Vector vGMLP004518 Human S100G Lentivirus particle


    Target information

    Target ID GM-T06819
    Target Name S100G
    Gene ID 795, 12309, 713702, 24249, 123383261, 607826, 281658, 100033995
    Gene Symbol and Synonyms CABP,CaBP-D9K,CABP1,CABP9K,CALB3,Cbpi,Rncalbd9,S100D,S100G
    Uniprot Accession P29377
    Uniprot Entry Name S100G_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000169906
    Target Classification Not Available

    This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.