Human CDNF/ARMETL1 ORF/cDNA clone-Lentivirus plasmid (NM_001029954)

Cat. No.: pGMLP004540
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDNF/ARMETL1 Lentiviral expression plasmid for CDNF lentivirus packaging, CDNF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CDNF/ARMETL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004540
Gene Name CDNF
Accession Number NM_001029954
Gene ID 441549
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 564 bp
Gene Alias ARMETL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGTGCGCGAGCCCAGTTGCTGTGGTGGCCTTTTGCGCCGGGCTTTTGGTCTCTCACCCGGTGCTGACGCAGGGCCAGGAGGCCGGGGGGCGGCCAGGGGCCGACTGTGAAGTATGTAAAGAATTCTTGAACCGATTCTACAAGTCACTGATAGACAGAGGAGTTAACTTTTCGCTGGACACTATAGAGAAAGAATTGATCAGTTTTTGCTTGGACACCAAAGGAAAAGAAAACCGCCTGTGCTATTATCTAGGAGCCACAAAAGACGCAGCCACAAAGATCCTAAGTGAAGTCACTCGCCCAATGAGTGTGCATATGCCTGCAATGAAGATTTGTGAGAAGCTGAAGAAGTTGGATAGCCAGATCTGTGAGCTGAAATATGAAAAAACACTGGACTTGGCATCAGTTGACCTGCGGAAGATGAGAGTGGCAGAGCTGAAGCAGATCCTGCATAGCTGGGGGGAGGAGTGCAGGGCCTGTGCAGAAAAAACTGACTATGTGAATCTCATTCAAGAGCTGGCCCCCAAGTATGCAGCGACACACCCCAAAACAGAGCTCTGA
ORF Protein Sequence MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0754-Ab Anti-CDNF/ ARMETL1 functional antibody
    Target Antigen GM-Tg-g-SE0754-Ag CDNF protein
    ORF Viral Vector pGMLP004540 Human CDNF Lentivirus plasmid
    ORF Viral Vector vGMLP004540 Human CDNF Lentivirus particle


    Target information

    Target ID GM-SE0754
    Target Name CDNF
    Gene ID 441549, 227526, 697138, 361276, 101098963, 607252, 513798, 100056424
    Gene Symbol and Synonyms 9330140G23,ARMETL1,CDNF
    Uniprot Accession Q49AH0
    Uniprot Entry Name CDNF_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000185267
    Target Classification Not Available

    Predicted to enable growth factor activity. Predicted to be involved in dopaminergic neuron differentiation and neuron projection development. Predicted to be active in endoplasmic reticulum and extracellular space. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.