Human PTH2/TIP39 ORF/cDNA clone-Lentivirus plasmid (NM_178449)
Cat. No.: pGMLP004556
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PTH2/TIP39 Lentiviral expression plasmid for PTH2 lentivirus packaging, PTH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PTH2/TIP39 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004556 |
Gene Name | PTH2 |
Accession Number | NM_178449 |
Gene ID | 113091 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 303 bp |
Gene Alias | TIP39 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGACCCGCCAGGTGTCCAGGAGCCCTCGGGTTCGGCTGCTGCTGCTGCTGCTGCTGCTGCTGGTGGTGCCCTGGGGCGTCCGCACTGCCTCGGGAGTCGCCCTGCCCCCGGTCGGGGTCCTCAGCCTCCGCCCCCCAGGACGGGCCTGGGCGGATCCCGCCACCCCCAGGCCGCGGAGGAGCCTGGCGCTGGCGGACGACGCGGCCTTCCGGGAGCGCGCGCGGTTGCTGGCCGCCCTCGAGCGCCGCCACTGGCTGAACTCGTACATGCACAAGCTGCTGGTGTTGGATGCGCCCTGA |
ORF Protein Sequence | METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0438-Ab | Anti-TIP39/ PTH2 functional antibody |
Target Antigen | GM-Tg-g-SE0438-Ag | PTH2 protein |
ORF Viral Vector | pGMLP004556 | Human PTH2 Lentivirus plasmid |
ORF Viral Vector | vGMLP004556 | Human PTH2 Lentivirus particle |
Target information
Target ID | GM-SE0438 |
Target Name | PTH2 |
Gene ID | 113091, 114640, 718758, 499149, 101097688, 100856662, 617680, 100051792 |
Gene Symbol and Synonyms | PTH2,RGD1559447,Tifp39,TIP39 |
Uniprot Accession | Q96A98 |
Uniprot Entry Name | TIP39_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000142538 |
Target Classification | Not Available |
This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.