Human PTH2/TIP39 ORF/cDNA clone-Lentivirus plasmid (NM_178449)

Cat. No.: pGMLP004556
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTH2/TIP39 Lentiviral expression plasmid for PTH2 lentivirus packaging, PTH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PTH2/TIP39 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004556
Gene Name PTH2
Accession Number NM_178449
Gene ID 113091
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 303 bp
Gene Alias TIP39
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGACCCGCCAGGTGTCCAGGAGCCCTCGGGTTCGGCTGCTGCTGCTGCTGCTGCTGCTGCTGGTGGTGCCCTGGGGCGTCCGCACTGCCTCGGGAGTCGCCCTGCCCCCGGTCGGGGTCCTCAGCCTCCGCCCCCCAGGACGGGCCTGGGCGGATCCCGCCACCCCCAGGCCGCGGAGGAGCCTGGCGCTGGCGGACGACGCGGCCTTCCGGGAGCGCGCGCGGTTGCTGGCCGCCCTCGAGCGCCGCCACTGGCTGAACTCGTACATGCACAAGCTGCTGGTGTTGGATGCGCCCTGA
ORF Protein Sequence METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0438-Ab Anti-TIP39/ PTH2 functional antibody
    Target Antigen GM-Tg-g-SE0438-Ag PTH2 protein
    ORF Viral Vector pGMLP004556 Human PTH2 Lentivirus plasmid
    ORF Viral Vector vGMLP004556 Human PTH2 Lentivirus particle


    Target information

    Target ID GM-SE0438
    Target Name PTH2
    Gene ID 113091, 114640, 718758, 499149, 101097688, 100856662, 617680, 100051792
    Gene Symbol and Synonyms PTH2,RGD1559447,Tifp39,TIP39
    Uniprot Accession Q96A98
    Uniprot Entry Name TIP39_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000142538
    Target Classification Not Available

    This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.