Human SNCG/BCSG1/SR ORF/cDNA clone-Lentivirus plasmid (NM_003087)

Cat. No.: pGMLP004606
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SNCG/BCSG1/SR Lentiviral expression plasmid for SNCG lentivirus packaging, SNCG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SNCG/BCSG1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004606
Gene Name SNCG
Accession Number NM_003087
Gene ID 6623
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 384 bp
Gene Alias BCSG1,SR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGTCTTCAAGAAGGGCTTCTCCATCGCCAAGGAGGGCGTGGTGGGTGCGGTGGAAAAGACCAAGCAGGGGGTGACGGAAGCAGCTGAGAAGACCAAGGAGGGGGTCATGTATGTGGGAGCCAAGACCAAGGAGAATGTTGTACAGAGCGTGACCTCAGTGGCCGAGAAGACCAAGGAGCAGGCCAACGCCGTGAGCGAGGCTGTGGTGAGCAGCGTCAACACTGTGGCCACCAAGACCGTGGAGGAGGCGGAGAACATCGCGGTCACCTCCGGGGTGGTGCGCAAGGAGGACTTGAGGCCATCTGCCCCCCAACAGGAGGGTGAGGCATCCAAAGAGAAAGAGGAAGTGGCAGAGGAGGCCCAGAGTGGGGGAGACTAG
ORF Protein Sequence MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T90360-Ab Anti-SNCG monoclonal antibody
    Target Antigen GM-Tg-g-T90360-Ag SNCG protein
    ORF Viral Vector pGMLP004606 Human SNCG Lentivirus plasmid
    ORF Viral Vector vGMLP004606 Human SNCG Lentivirus particle


    Target information

    Target ID GM-T90360
    Target Name SNCG
    Gene ID 6623, 20618, 696535, 64347, 101086006, 611053, 281494, 100052349
    Gene Symbol and Synonyms BCSG1,persyn,SNCG,SR
    Uniprot Accession O76070
    Uniprot Entry Name SYUG_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Malignant neoplasm of bladder
    Gene Ensembl ENSG00000173267
    Target Classification Not Available

    This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq, Jan 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.