Human RNF185 ORF/cDNA clone-Lentivirus plasmid (NM_152267)

Cat. No.: pGMLP004610
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNF185/ Lentiviral expression plasmid for RNF185 lentivirus packaging, RNF185 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RNF185/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $444.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004610
Gene Name RNF185
Accession Number NM_152267
Gene ID 91445
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAAGCAAGGGGCCCTCGGCCTCTGCATCTCCTGAGAACTCCAGTGCAGGGGGGCCCAGTGGGAGCAGCAATGGCGCTGGCGAGAGCGGAGGGCAGGACAGCACTTTCGAGTGCAACATCTGCTTGGACACAGCCAAGGATGCCGTCATCAGCCTGTGTGGCCACCTCTTCTGTTGGCCGTGTTTACATCAGTGGTTGGAGACCAGACCTAACAGACAGGTGTGTCCTGTTTGCAAAGCTGGCATCAGCCGAGACAAGGTCATCCCCCTCTATGGAAGGGGCAGCACTGGGCAACAGGACCCCAGAGAGAAGACCCCTCCTCGTCCTCAAGGACAGAGGCCAGAGCCGGAGAATAGAGGGGGATTTCAAGGATTTGGATTTGGAGATGGTGGCTTCCAGATGTCTTTTGGAATTGGGGCATTTCCCTTTGGGATATTTGCCACAGCATTTAATATAAATGATGGGCGGCCTCCTCCAGCTGTCCCTGGGACACCCCAGTATGTGGACGAGCAGTTCCTGTCACGCCTCTTCCTATTTGTGGCCCTGGTGATCATGTTCTGGCTCCTGATTGCCTAA
ORF Protein Sequence MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1520-Ab Anti-RNF185 monoclonal antibody
    Target Antigen GM-Tg-g-IP1520-Ag RNF185 protein
    ORF Viral Vector pGMLP004610 Human RNF185 Lentivirus plasmid
    ORF Viral Vector vGMLP004610 Human RNF185 Lentivirus particle


    Target information

    Target ID GM-IP1520
    Target Name RNF185
    Gene ID 91445, 193670, 718351, 360967, 101096516, 486362, 524459, 100058463
    Gene Symbol and Synonyms RNF185
    Uniprot Accession Q96GF1
    Uniprot Entry Name RN185_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000138942
    Target Classification Not Available

    Enables ubiquitin binding activity; ubiquitin protein ligase activity; and ubiquitin-like protein conjugating enzyme binding activity. Involved in positive regulation of ERAD pathway; protein autoubiquitination; and ubiquitin-dependent ERAD pathway. Located in endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.