Human ARL6IP1/AIP1/ARL6IP ORF/cDNA clone-Lentivirus plasmid (NM_015161)

Cat. No.: pGMLP004618
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ARL6IP1/AIP1/ARL6IP Lentiviral expression plasmid for ARL6IP1 lentivirus packaging, ARL6IP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ARL6IP1/AIP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $453
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004618
Gene Name ARL6IP1
Accession Number NM_015161
Gene ID 23204
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 612 bp
Gene Alias AIP1,ARL6IP,ARMER,SPG61
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAGGGAGATAATCGCAGCACCAACCTGCTGGCTGCAGAGACTGCAAGTCTGGAAGAACAGCTGCAAGGATGGGGAGAAGTGATGCTGATGGCTGATAAAGTCCTCCGATGGGAAAGAGCCTGGTTTCCACCTGCCATCATGGGTGTGGTTTCTTTGGTGTTTCTGATTATCTACTATCTAGATCCATCTGTTCTGTCCGGCGTTTCCTGTTTTGTTATGTTTTTGTGCTTGGCTGACTACCTTGTTCCCATTCTAGCGCCTAGAATTTTTGGCTCCAATAAATGGACCACTGAACAACAGCAAAGATTCCATGAAATTTGCAGCAATCTAGTAAAAACTCGACGCAGAGCTGTGGGTTGGTGGAAACGCCTCTTCACACTAAAGGAAGAAAAACCTAAGATGTACTTCATGACCATGATCGTTTCCCTTGCTGCGGTTGCTTGGGTGGGACAACAAGTCCACAACCTGCTTCTCACCTACCTGATAGTGACTTCCTTACTATTGCTTCCTGGACTAAACCAACATGGAATCATTTTGAAGTACATTGGAATGGCCAAGAGGGAGATAAACAAACTTCTCAAACAAAAAGAAAAGAAAAACGAATGA
ORF Protein Sequence MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0352-Ab Anti-ARL6IP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0352-Ag ARL6IP1 protein
    ORF Viral Vector pGMLP004618 Human ARL6IP1 Lentivirus plasmid
    ORF Viral Vector vGMLP004618 Human ARL6IP1 Lentivirus particle


    Target information

    Target ID GM-IP0352
    Target Name ARL6IP1
    Gene ID 23204, 54208, 693296, 293551, 101095460, 480791, 777773, 100050211
    Gene Symbol and Synonyms Aip-1,AIP-6,AIP1,ARL6IP,ARL6IP1,ARMER,mKIAA0069,SPG61
    Uniprot Accession Q15041
    Uniprot Entry Name AR6P1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170540
    Target Classification Not Available

    This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.