Human SEC22B/ERS-24/SEC22L1 ORF/cDNA clone-Lentivirus plasmid (NM_004892)

Cat. No.: pGMLP004627
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SEC22B/ERS-24/SEC22L1 Lentiviral expression plasmid for SEC22B lentivirus packaging, SEC22B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SEC22B/ERS-24 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004627
Gene Name SEC22B
Accession Number NM_004892
Gene ID 9554
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 648 bp
Gene Alias ERS-24,SEC22L1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGTTGCTAACAATGATCGCCCGAGTGGCGGACGGGCTCCCGCTGGCCGCCTCGATGCAGGAGGACGAACAGTCTGGCCGGGACCTTCAACAATATCAGAGTCAGGCTAAGCAACTCTTTCGAAAGTTGAATGAACAGTCCCCTACCAGATGTACCTTGGAAGCAGGAGCCATGACTTTTCACTACATTATTGAGCAGGGGGTGTGTTATTTGGTTTTATGTGAAGCTGCCTTCCCTAAGAAGTTGGCTTTTGCCTACCTAGAAGATTTGCACTCAGAATTTGATGAACAGCATGGAAAGAAGGTGCCCACTGTGTCCCGACCCTATTCCTTTATTGAATTTGATACTTTCATTCAGAAAACCAAGAAGCTCTACATTGACAGTCGTGCTCGAAGAAATCTAGGCTCCATCAACACTGAATTGCAAGATGTGCAGAGGATCATGGTGGCCAATATTGAAGAAGTGTTACAACGAGGAGAAGCACTCTCAGCATTGGATTCAAAGGCTAACAATTTGTCCAGTCTGTCCAAGAAATACCGCCAGGATGCGAAGTACTTGAACATGCGTTCCACTTATGCCAAACTTGCAGCAGTAGCTGTATTTTTCATCATGTTAATAGTGTATGTCCGATTCTGGTGGCTGTGA
ORF Protein Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1595-Ab Anti-SEC22B monoclonal antibody
    Target Antigen GM-Tg-g-IP1595-Ag SEC22B protein
    ORF Viral Vector pGMLP004627 Human SEC22B Lentivirus plasmid
    ORF Viral Vector vGMLP004627 Human SEC22B Lentivirus particle


    Target information

    Target ID GM-IP1595
    Target Name SEC22B
    Gene ID 9554, 20333, 713856, 310710, 101089536, 475816, 614775
    Gene Symbol and Synonyms 4930564D15Rik,ERS-24,SEC22B,SEC22L1
    Uniprot Accession O75396
    Uniprot Entry Name SC22B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000265808
    Target Classification Not Available

    The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.[provided by RefSeq, Sep 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.