Human RABGGTB/GGTB ORF/cDNA clone-Lentivirus plasmid (NM_004582)
Cat. No.: pGMLP004633
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RABGGTB/GGTB Lentiviral expression plasmid for RABGGTB lentivirus packaging, RABGGTB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RABGGTB/GGTB products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004633 |
Gene Name | RABGGTB |
Accession Number | NM_004582 |
Gene ID | 5876 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 996 bp |
Gene Alias | GGTB |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCACTCCACAGAAGGATGTTATTATCAAGTCAGATGCACCGGACACTTTGTTATTGGAGAAACATGCAGATTATATCGCATCCTATGGCTCAAAGAAAGATGATTATGAATACTGTATGTCTGAGTATTTGAGAATGAGTGGCATCTATTGGGGTCTGACAGTAATGGATCTCATGGGACAACTTCATCGCATGAATAGAGAAGAGATTCTGGCATTTATTAAGTCTTGCCAACATGAATGTGGTGGAATAAGTGCTAGTATCGGACATGATCCTCATCTTTTATACACTCTTAGTGCTGTCCAGATTCTTACGCTGTATGACAGTATTAATGTTATTGACGTAAATAAAGTTGTGGAATATGTTAAAGGTCTACAGAAAGAAGATGGTTCTTTTGCTGGAGATATTTGGGGAGAAATTGACACAAGATTCTCTTTTTGTGCGGTGGCAACTTTGGCTTTGTTGGGGAAGCTTGATGCTATTAATGTGGAAAAGGCAATCGAATTTGTTTTATCCTGTATGAACTTTGACGGTGGATTTGGTTGCAGACCAGGTTCTGAATCCCATGCTGGGCAGATCTATTGTTGCACAGGATTTCTGGCAATTACAAGTCAGTTGCATCAAGTAAATTCTGATTTACTTGGCTGGTGGCTTTGTGAACGACAATTACCCTCAGGCGGGCTCAATGGAAGGCCGGAGAAGTTACCAGATGTATGCTACTCATGGTGGGTCCTGGCTTCCCTAAAGATAATTGGAAGACTTCATTGGATTGATAGAGAGAAACTGCGTAATTTCATTTTAGCATGTCAAGATGAAGAAACGGGGGGATTTGCAGACAGGCCAGGAGATATGGTGGATCCTTTTCATACCTTATTTGGAATTGCTGGATTGTCACTTTTGGGAGAAGAACAGATTAAACCTGTTAATCCTGTCTTTTGCATGCCTGAAGAAGTGCTTCAGAGAGTGAATGTTCAGCCTGAGCTAGTGAGCTAG |
ORF Protein Sequence | MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA119-Ab | Anti-RABGGTB monoclonal antibody |
Target Antigen | GM-Tg-g-TA119-Ag | RABGGTB protein |
ORF Viral Vector | pGMLP004633 | Human RABGGTB Lentivirus plasmid |
ORF Viral Vector | vGMLP004633 | Human RABGGTB Lentivirus particle |
Target information
Target ID | GM-TA119 |
Target Name | RABGGTB |
Gene ID | 5876, 19352, 705421, 25533, 101090281, 612683, 533276, 100067295 |
Gene Symbol and Synonyms | GGTB,RABGGTB |
Uniprot Accession | P53611 |
Uniprot Entry Name | PGTB2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000137955 |
Target Classification | Not Available |
This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residues of Rab GTPases. Three small nucleolar RNA genes are present in the intronic regions of this gene. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 3. [provided by RefSeq, Jan 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.