Human RABGGTB/GGTB ORF/cDNA clone-Lentivirus plasmid (NM_004582)

Cat. No.: pGMLP004633
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RABGGTB/GGTB Lentiviral expression plasmid for RABGGTB lentivirus packaging, RABGGTB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RABGGTB/GGTB products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $549
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004633
Gene Name RABGGTB
Accession Number NM_004582
Gene ID 5876
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias GGTB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCACTCCACAGAAGGATGTTATTATCAAGTCAGATGCACCGGACACTTTGTTATTGGAGAAACATGCAGATTATATCGCATCCTATGGCTCAAAGAAAGATGATTATGAATACTGTATGTCTGAGTATTTGAGAATGAGTGGCATCTATTGGGGTCTGACAGTAATGGATCTCATGGGACAACTTCATCGCATGAATAGAGAAGAGATTCTGGCATTTATTAAGTCTTGCCAACATGAATGTGGTGGAATAAGTGCTAGTATCGGACATGATCCTCATCTTTTATACACTCTTAGTGCTGTCCAGATTCTTACGCTGTATGACAGTATTAATGTTATTGACGTAAATAAAGTTGTGGAATATGTTAAAGGTCTACAGAAAGAAGATGGTTCTTTTGCTGGAGATATTTGGGGAGAAATTGACACAAGATTCTCTTTTTGTGCGGTGGCAACTTTGGCTTTGTTGGGGAAGCTTGATGCTATTAATGTGGAAAAGGCAATCGAATTTGTTTTATCCTGTATGAACTTTGACGGTGGATTTGGTTGCAGACCAGGTTCTGAATCCCATGCTGGGCAGATCTATTGTTGCACAGGATTTCTGGCAATTACAAGTCAGTTGCATCAAGTAAATTCTGATTTACTTGGCTGGTGGCTTTGTGAACGACAATTACCCTCAGGCGGGCTCAATGGAAGGCCGGAGAAGTTACCAGATGTATGCTACTCATGGTGGGTCCTGGCTTCCCTAAAGATAATTGGAAGACTTCATTGGATTGATAGAGAGAAACTGCGTAATTTCATTTTAGCATGTCAAGATGAAGAAACGGGGGGATTTGCAGACAGGCCAGGAGATATGGTGGATCCTTTTCATACCTTATTTGGAATTGCTGGATTGTCACTTTTGGGAGAAGAACAGATTAAACCTGTTAATCCTGTCTTTTGCATGCCTGAAGAAGTGCTTCAGAGAGTGAATGTTCAGCCTGAGCTAGTGAGCTAG
ORF Protein Sequence MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA119-Ab Anti-RABGGTB monoclonal antibody
    Target Antigen GM-Tg-g-TA119-Ag RABGGTB protein
    ORF Viral Vector pGMLP004633 Human RABGGTB Lentivirus plasmid
    ORF Viral Vector vGMLP004633 Human RABGGTB Lentivirus particle


    Target information

    Target ID GM-TA119
    Target Name RABGGTB
    Gene ID 5876, 19352, 705421, 25533, 101090281, 612683, 533276, 100067295
    Gene Symbol and Synonyms GGTB,RABGGTB
    Uniprot Accession P53611
    Uniprot Entry Name PGTB2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000137955
    Target Classification Not Available

    This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residues of Rab GTPases. Three small nucleolar RNA genes are present in the intronic regions of this gene. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 3. [provided by RefSeq, Jan 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.