Human IV/IV/SIAT3-C ORF/cDNA clone-Lentivirus plasmid (NM_175039)
Cat. No.: pGMLP004730
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IV/IV/SIAT3-C Lentiviral expression plasmid for IV lentivirus packaging, IV lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
ST6GALNAC4/IV products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004730 |
Gene Name | IV |
Accession Number | NM_175039 |
Gene ID | 27090 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 909 bp |
Gene Alias | IV,SIAT3-C,SIAT3C,SIAT7-D,SIAT7D,ST6GalNAc,ST6GALNACIV |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGGCTCCGGGTCGGCTCGTGCTCATCATCCTGTGCTCCGTGGTCTTCTCTGCCGTCTACATCCTCCTGTGCTGCTGGGCCGGCCTGCCCCTCTGCCTGGCCACCTGCCTGGACCACCACTTCCCCACAGGCTCCAGGCCCACTGTGCCGGGACCCCTGCACTTCAGTGGATATAGCAGTGTGCCAGATGGGAAGCCGCTGGTCCGCGAGCCCTGCCGCAGCTGTGCCGTGGTGTCCAGCTCCGGCCAAATGCTGGGCTCAGGCCTGGGTGCTGAGATCGACAGTGCCGAGTGCGTGTTCCGCATGAACCAGGCGCCCACCGTGGGCTTTGAGGCGGATGTGGGCCAGCGCAGCACCCTGCGTGTCGTCTCACACACAAGCGTGCCGCTGCTGCTGCGCAACTATTCACACTACTTCCAGAAGGCCCGAGACACGCTCTACATGGTGTGGGGCCAGGGCAGGCACATGGACCGGGTGCTCGGCGGCCGCACCTACCGCACGCTGCTGCAGCTCACCAGGATGTACCCCGGCCTGCAGGTGTACACCTTCACGGAGCGCATGATGGCCTACTGCGACCAGATCTTCCAGGACGAGACGGGCAAGAACCGGAGGCAGTCGGGCTCCTTCCTCAGCACCGGCTGGTTCACCATGATCCTCGCGCTGGAGCTGTGTGAGGAGATCGTGGTCTATGGGATGGTCAGCGACAGCTACTGCAGGGAGAAGAGCCACCCCTCAGTGCCTTACCACTACTTTGAGAAGGGCCGGCTAGATGAGTGTCAGATGTACCTGGCACACGAGCAGGCGCCCCGAAGCGCCCACCGCTTCATCACTGAGAAGGCGGTCTTCTCCCGCTGGGCCAAGAAGAGGCCCATCGTGTTCGCCCATCCGTCCTGGAGGACTGAGTAG |
ORF Protein Sequence | MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1832-Ab | Anti-ST6GALNAC4 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1832-Ag | ST6GALNAC4 protein |
ORF Viral Vector | pGMLP004730 | Human IV Lentivirus plasmid |
ORF Viral Vector | vGMLP004730 | Human IV Lentivirus particle |
Target information
Target ID | GM-IP1832 |
Target Name | ST6GALNAC4 |
Gene ID | 27090, 20448, 705879, 407764, 101094459, 609133, 404124, 100067121 |
Gene Symbol and Synonyms | IV,SIAT3-C,SIAT3C,SIAT7-D,SIAT7B,SIAT7D,ST6GalNAc,st6GalNAc-IV,ST6GALNAC2,ST6GALNAC4,ST6GALNACIV |
Uniprot Accession | Q9H4F1 |
Uniprot Entry Name | SIA7D_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000136840 |
Target Classification | Not Available |
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene. Readthrough transcripts exist for this gene and the downstream ST6GALNAC6 gene. [provided by RefSeq, Jan 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.