Human FCN2/EBP-37/FCNL ORF/cDNA clone-Lentivirus plasmid (NM_004108)

Cat. No.: pGMLP004783
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FCN2/EBP-37/FCNL Lentiviral expression plasmid for FCN2 lentivirus packaging, FCN2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FCN2/EBP-37 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $535.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004783
Gene Name FCN2
Accession Number NM_004108
Gene ID 2220
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 942 bp
Gene Alias EBP-37,FCNL,ficolin-2,P35
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCTGGACAGAGCTGTGGGGGTCCTGGGCGCTGCCACCCTGCTGCTCTCTTTCCTGGGCATGGCCTGGGCTCTCCAGGCGGCAGACACCTGTCCAGAGGTGAAGATGGTGGGCCTGGAGGGCTCTGACAAGCTCACCATTCTCCGAGGCTGTCCGGGGCTGCCTGGGGCCCCTGGGCCCAAGGGAGAGGCAGGCACCAATGGAAAGAGAGGAGAACGTGGCCCCCCTGGACCTCCTGGGAAGGCAGGACCACCTGGGCCCAACGGAGCACCTGGGGAGCCCCAGCCGTGCCTGACAGGCCCGCGTACCTGCAAGGACCTGCTAGACCGAGGGCACTTCCTGAGCGGCTGGCACACCATCTACCTGCCCGACTGCCGGCCCCTGACTGTGCTCTGTGACATGGACACGGACGGAGGGGGCTGGACCGTTTTCCAGCGGAGGGTGGATGGCTCTGTGGACTTCTACCGGGACTGGGCCACGTACAAGCAGGGCTTCGGCAGTCGGCTGGGGGAGTTCTGGCTGGGGAATGACAACATCCACGCCCTGACCGCCCAGGGAACCAGCGAGCTCCGTGTAGACCTGGTGGACTTTGAGGACAACTACCAGTTTGCTAAGTACAGATCATTCAAGGTGGCCGACGAGGCGGAGAAGTACAATCTGGTCCTGGGGGCCTTCGTGGAGGGCAGTGCGGGAGATTCCCTGACGTTCCACAACAACCAGTCCTTCTCCACCAAAGACCAGGACAATGATCTTAACACCGGAAATTGTGCTGTGATGTTTCAGGGAGCTTGGTGGTACAAAAACTGCCATGTGTCAAACCTGAATGGTCGCTACCTCAGGGGGACTCATGGCAGCTTTGCAAATGGCATCAACTGGAAGTCGGGGAAAGGATACAATTATAGCTACAAGGTGTCAGAGATGAAGGTGCGACCTGCCTAG
ORF Protein Sequence MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0211-Ab Anti-FCN2/ EBP-37/ FCNL functional antibody
    Target Antigen GM-Tg-g-SE0211-Ag FCN2 protein
    ORF Viral Vector pGMLP004783 Human FCN2 Lentivirus plasmid
    ORF Viral Vector vGMLP004783 Human FCN2 Lentivirus particle


    Target information

    Target ID GM-SE0211
    Target Name FCN2
    Gene ID 2220, 608247
    Gene Symbol and Synonyms EBP-37,FCN1,FCN2,FCNL,ficolin-2,P35
    Uniprot Accession Q15485
    Uniprot Entry Name FCN2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160339
    Target Classification Not Available

    The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.