Human KDSR/DHSR/EKVP4 ORF/cDNA clone-Lentivirus plasmid (NM_002035)

Cat. No.: pGMLP004807
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KDSR/DHSR/EKVP4 Lentiviral expression plasmid for KDSR lentivirus packaging, KDSR lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to KDSR/DHSR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $549.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004807
Gene Name KDSR
Accession Number NM_002035
Gene ID 2531
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 999 bp
Gene Alias DHSR,EKVP4,FVT1,SDR35C1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCTGCTGGCTGCCGCCTTCCTCGTGGCCTTCGTGCTGCTGCTGTACATGGTGTCTCCGCTCATCAGCCCCAAGCCCCTCGCCCTGCCCGGGGCGCATGTGGTGGTTACAGGAGGTTCCAGTGGCATCGGGAAGTGCATTGCTATCGAGTGCTATAAACAAGGAGCTTTTATAACTCTGGTTGCACGAAATGAGGATAAGCTGCTGCAGGCAAAGAAAGAAATTGAAATGCACTCTATTAATGACAAACAGGTGGTGCTTTGCATATCAGTTGATGTATCTCAAGACTATAACCAAGTAGAGAATGTCATAAAACAAGCACAGGAGAAACTGGGTCCAGTGGACATGCTGGTAAATTGTGCAGGAATGGCAGTGTCAGGAAAATTTGAAGATCTTGAAGTTAGTACCTTTGAAAGGTTAATGAGCATCAATTACCTGGGCAGCGTGTACCCCAGCCGGGCCGTGATCACCACCATGAAGGAGCGCCGGGTGGGCAGGATCGTGTTTGTGTCCTCCCAGGCAGGACAGTTGGGATTATTCGGTTTCACAGCCTACTCTGCATCCAAGTTTGCCATAAGGGGATTGGCAGAAGCTTTGCAGATGGAGGTGAAGCCATATAATGTCTACATCACAGTTGCTTACCCACCAGACACAGACACACCTGGCTTTGCCGAAGAAAACAGAACAAAGCCTTTGGAGACTCGACTTATTTCAGAGACCACATCTGTGTGCAAACCAGAACAGGTGGCCAAACAAATTGTTAAAGATGCCATACAAGGAAATTTCAACAGTTCCCTTGGCTCAGATGGGTACATGCTCTCGGCCCTGACCTGTGGGATGGCTCCAGTAACTTCTATTACTGAGGGGCTCCAGCAGGTGGTCACCATGGGCCTTTTCCGCACTATTGCTTTGTTTTACCTTGGAAGTTTTGACAGCATAGTTCGTCGCTGCATGATGCAGAGAGAAAAATCTGAAAATGCAGACAAAACTGCCTAA
ORF Protein Sequence MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1044-Ab Anti-KDSR monoclonal antibody
    Target Antigen GM-Tg-g-IP1044-Ag KDSR protein
    ORF Viral Vector pGMLP004807 Human KDSR Lentivirus plasmid
    ORF Viral Vector vGMLP004807 Human KDSR Lentivirus particle


    Target information

    Target ID GM-IP1044
    Target Name KDSR
    Gene ID 2531, 70750, 700476, 360833, 101091658, 609655, 505558, 100057259
    Gene Symbol and Synonyms 6330410P18Rik,9430079B08Rik,DHSR,EKVP4,FVT1,KDSR,SDR35C1
    Uniprot Accession Q06136
    Uniprot Entry Name KDSR_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000119537
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.