Human PPIL3/CYPJ ORF/cDNA clone-Lentivirus plasmid (NM_032472)

Cat. No.: pGMLP004832
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPIL3/CYPJ Lentiviral expression plasmid for PPIL3 lentivirus packaging, PPIL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PPIL3/CYPJ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004832
Gene Name PPIL3
Accession Number NM_032472
Gene ID 53938
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 498 bp
Gene Alias CYPJ
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGTGACACTGCATACAGATGTAGGTGATATTAAAATTGAAGTCTTCTGTGAGAGGACACCCAAAACATGTGAGATGGAGTCTCGCTGTGTCCCCCAGGCTGGAGTACAATGGCGCGATCTCGGCTCACTGCAACCTCCGCCTCCTGGGTTCAAGCAAGTCTTCTGCCTCAGCCTCCCGAGAACTGGAAGAGGAGGCAACAGTATTTGGGGCAAGAAGTTTGAGGATGAATACAGTGAATATCTTAAGCACAATGTTAGAGGTGTTGTATCTATGGCTAATAATGGCCCGAACACCAATGGATCTCAGTTCTTCATCACCTATGGCAAACAGCCACATTTGGACATGAAATACACCGTATTTGGAAAGGTAATAGATGGTCTGGAAACTCTAGATGAGTTGGAGAAGTTGCCAGTAAATGAGAAGACATACCGACCTCTTAATGATGTACACATTAAGGACATAACTATTCATGCCAACCCATTTGCTCAGTAG
ORF Protein Sequence MSVTLHTDVGDIKIEVFCERTPKTCEMESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1435-Ab Anti-PPIL3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1435-Ag PPIL3 protein
    ORF Viral Vector pGMLP004832 Human PPIL3 Lentivirus plasmid
    ORF Viral Vector vGMLP004832 Human PPIL3 Lentivirus particle


    Target information

    Target ID GM-IP1435
    Target Name PPIL3
    Gene ID 53938, 70225, 700456, 301432, 101092630, 607430, 615703, 100067857
    Gene Symbol and Synonyms 2310076N22Rik,2510026K04Rik,Cyp10l,CYPJ,PPIL3
    Uniprot Accession Q9H2H8
    Uniprot Entry Name PPIL3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000240344
    Target Classification Not Available

    This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.