Human FAM72D/GCUD2 ORF/cDNA clone-Lentivirus plasmid (NM_001345942)

Cat. No.: pGMLP004842
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FAM72D/GCUD2 Lentiviral expression plasmid for FAM72D lentivirus packaging, FAM72D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FAM72D/GCUD2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004842
Gene Name FAM72D
Accession Number NM_001345942
Gene ID 728833
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 450 bp
Gene Alias GCUD2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAACGACGACTGCCCTACGGTGGACCGCGGCTGCCCGTGTGCGGAGGAAAGGGAGAGGCGGCTGGGTGCCGGCTGCGCTGCGGTCCGTGAGCCAGGACAGAGTCCCAGGCTGTACAGTGATGGGCGGAGAGACTCGCAGTCCTGAGAACGCAGTGGACTTCACTGGAAGATGCTATTTCACCAAAATCTGCAAATGTAAACTGAAGGACATCGCATGTTTAAAATGTGGGAACATTGTAGGTTATCATGTGATTGTTCCATGTAGTTCCTGTCTTCTTTCCTGCAACAACAGACACTTCTGGATGTTTCACAGCCAGGCAGTTTATGATATTAACAGACTAGACTCCACAGGTGTAAACGTCCTACTTCGGGGCAACTTGCCAGAGATAGAAGAGAGTACAGATGAAGATGTGTTAAATATCTCAGCAGAGGAGTGTATTAGATAA
ORF Protein Sequence MPTTTALRWTAAARVRRKGRGGWVPAALRSVSQDRVPGCTVMGGETRSPENAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2493-Ab Anti-FAM72D monoclonal antibody
    Target Antigen GM-Tg-g-IP2493-Ag FAM72D protein
    ORF Viral Vector pGMLP004842 Human FAM72D Lentivirus plasmid
    ORF Viral Vector vGMLP004842 Human FAM72D Lentivirus particle


    Target information

    Target ID GM-IP2493
    Target Name FAM72D
    Gene ID 728833
    Gene Symbol and Synonyms FAM72D,GCUD2
    Uniprot Accession Q6L9T8
    Uniprot Entry Name FA72D_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000215784
    Target Classification Not Available

    Located in cytosol and intracellular membrane-bounded organelle. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.