Human MYL4/ALC1/AMLC ORF/cDNA clone-Lentivirus plasmid (NM_002476)

Cat. No.: pGMLP004880
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MYL4/ALC1/AMLC Lentiviral expression plasmid for MYL4 lentivirus packaging, MYL4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MYL4/ALC1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $448.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004880
Gene Name MYL4
Accession Number NM_002476
Gene ID 4635
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 594 bp
Gene Alias ALC1,AMLC,GT1,PRO1957
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCCAAGAAGCCTGAGCCTAAGAAGGAGGCAGCCAAGCCAGCTCCAGCTCCAGCTCCAGCCCCTGCACCAGCCCCTGCCCCAGCTCCTGAGGCTCCCAAGGAACCTGCCTTTGACCCCAAGAGTGTAAAGATAGACTTCACTGCCGACCAGATTGAAGAGTTCAAAGAGGCCTTTTCATTGTTTGACCGGACCCCGACTGGAGAGATGAAGATCACCTACGGCCAGTGCGGGGATGTACTGCGGGCCCTGGGCCAGAACCCTACCAATGCCGAGGTGCTGCGTGTGCTGGGCAAGCCCAAGCCTGAAGAGATGAATGTCAAGATGCTGGACTTTGAGACGTTCTTGCCCATCCTGCAGCACATTTCCCGCAACAAGGAGCAGGGCACCTATGAGGACTTCGTGGAGGGCCTGCGTGTCTTTGACAAGGAGAGCAATGGCACGGTCATGGGTGCTGAGCTTCGGCACGTCCTTGCCACCCTGGGAGAGAAGATGACTGAGGCTGAAGTGGAGCAGCTGTTAGCTGGGCAAGAGGATGCCAATGGCTGCATCAATTATGAAGCCTTTGTCAAGCACATCATGTCAGGGTGA
ORF Protein Sequence MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2615-Ab Anti-MYL4 monoclonal antibody
    Target Antigen GM-Tg-g-IP2615-Ag MYL4 protein
    ORF Viral Vector pGMLP004880 Human MYL4 Lentivirus plasmid
    ORF Viral Vector vGMLP004880 Human MYL4 Lentivirus particle


    Target information

    Target ID GM-IP2615
    Target Name MYL4
    Gene ID 4635, 17896, 717354, 688228, 100316866, 480490, 504201, 100054510
    Gene Symbol and Synonyms ALC1,AMLC,ELC,ELC1a,GT1,MLC1a,MLC1E/A,MLC1EMB,MYL4,Myla,PRO1957
    Uniprot Accession P12829
    Uniprot Entry Name MYL4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000198336
    Target Classification Not Available

    Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.