Human DEFB126/bA530N10.1/C20orf8 ORF/cDNA clone-Lentivirus plasmid (NM_030931)

Cat. No.: pGMLP004966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DEFB126/bA530N10.1/C20orf8 Lentiviral expression plasmid for DEFB126 lentivirus packaging, DEFB126 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DEFB126/bA530N10.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004966
Gene Name DEFB126
Accession Number NM_030931
Gene ID 81623
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 336 bp
Gene Alias bA530N10.1,C20orf8,DEFB-26,DEFB26,hBD-26,HBD26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCCCTACTGTTCACCCTTGCAGTTTTTATGCTCCTGGCCCAATTGGTCTCAGGTAATTGGTATGTGAAAAAGTGTCTAAACGACGTTGGAATTTGCAAGAAGAAGTGCAAACCTGAAGAGATGCATGTAAAGAATGGTTGGGCAATGTGCGGCAAACAAAGGGACTGCTGTGTTCCAGCTGACAGACGTGCTAATTATCCTGTTTTCTGTGTCCAGACAAAGACTACAAGAATTTCAACAGTAACAGCAACAACAGCAACAACAACTTTGATGATGACTACTGCTTCGATGTCTTCGATGGCTCCTACCCCCGTTTCTCCCACTGGTTGA
ORF Protein Sequence MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0152-Ab Anti-DB126/ DEFB126/ C20orf8 functional antibody
    Target Antigen GM-Tg-g-SE0152-Ag DEFB126 protein
    ORF Viral Vector pGMLP004966 Human DEFB126 Lentivirus plasmid
    ORF Viral Vector vGMLP004966 Human DEFB126 Lentivirus particle


    Target information

    Target ID GM-SE0152
    Target Name DEFB126
    Gene ID 81623, 442835, 714089, 171412, 100683529, 102147536
    Gene Symbol and Synonyms 2D6glycoprotein,9230002F21Rik,bA530N10.1,C20orf8,CBD141,DEFB-26,DEFB126,Defb22,DEFB26,hBD-26,HBD26
    Uniprot Accession Q9BYW3
    Uniprot Entry Name DB126_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000125788
    Target Classification Not Available

    Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. The encoded protein is highly similar to an epididymal-specific secretory protein (ESP13.2) from cynomolgus monkey. Mutation of this gene is associated with impaired sperm function. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.