Human DEFB126/bA530N10.1/C20orf8 ORF/cDNA clone-Lentivirus plasmid (NM_030931)
Cat. No.: pGMLP004966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DEFB126/bA530N10.1/C20orf8 Lentiviral expression plasmid for DEFB126 lentivirus packaging, DEFB126 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DEFB126/bA530N10.1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004966 |
Gene Name | DEFB126 |
Accession Number | NM_030931 |
Gene ID | 81623 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 336 bp |
Gene Alias | bA530N10.1,C20orf8,DEFB-26,DEFB26,hBD-26,HBD26 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGTCCCTACTGTTCACCCTTGCAGTTTTTATGCTCCTGGCCCAATTGGTCTCAGGTAATTGGTATGTGAAAAAGTGTCTAAACGACGTTGGAATTTGCAAGAAGAAGTGCAAACCTGAAGAGATGCATGTAAAGAATGGTTGGGCAATGTGCGGCAAACAAAGGGACTGCTGTGTTCCAGCTGACAGACGTGCTAATTATCCTGTTTTCTGTGTCCAGACAAAGACTACAAGAATTTCAACAGTAACAGCAACAACAGCAACAACAACTTTGATGATGACTACTGCTTCGATGTCTTCGATGGCTCCTACCCCCGTTTCTCCCACTGGTTGA |
ORF Protein Sequence | MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0152-Ab | Anti-DB126/ DEFB126/ C20orf8 functional antibody |
Target Antigen | GM-Tg-g-SE0152-Ag | DEFB126 protein |
ORF Viral Vector | pGMLP004966 | Human DEFB126 Lentivirus plasmid |
ORF Viral Vector | vGMLP004966 | Human DEFB126 Lentivirus particle |
Target information
Target ID | GM-SE0152 |
Target Name | DEFB126 |
Gene ID | 81623, 442835, 714089, 171412, 100683529, 102147536 |
Gene Symbol and Synonyms | 2D6glycoprotein,9230002F21Rik,bA530N10.1,C20orf8,CBD141,DEFB-26,DEFB126,Defb22,DEFB26,hBD-26,HBD26 |
Uniprot Accession | Q9BYW3 |
Uniprot Entry Name | DB126_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000125788 |
Target Classification | Not Available |
Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. The encoded protein is highly similar to an epididymal-specific secretory protein (ESP13.2) from cynomolgus monkey. Mutation of this gene is associated with impaired sperm function. [provided by RefSeq, Nov 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.