Human LASP1/Lasp-1/MLN50 ORF/cDNA clone-Lentivirus plasmid (NM_006148)
Cat. No.: pGMLP004976
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LASP1/Lasp-1/MLN50 Lentiviral expression plasmid for LASP1 lentivirus packaging, LASP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
LASP1/Lasp-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004976 |
Gene Name | LASP1 |
Accession Number | NM_006148 |
Gene ID | 3927 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 786 bp |
Gene Alias | Lasp-1,MLN50 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGTTCTGGCATAAAGCATGCTTCCATTGCGAGACCTGCAAGATGACACTGAACATGAAGAACTACAAGGGCTACGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAGTCCTTCACCATGGTGGCGGACACCCCGGAAAACCTTCGCCTCAAGCAACAGAGTGAGCTCCAGAGTCAGGTGCGCTACAAGGAGGAGTTTGAGAAGAACAAGGGCAAAGGTTTCAGCGTAGTGGCAGACACGCCCGAGCTCCAGAGAATCAAGAAGACCCAGGACCAGATCAGTAACATAAAATACCATGAGGAGTTTGAGAAGAGCCGCATGGGCCCTAGCGGGGGCGAGGGCATGGAGCCAGAGCGTCGGGATTCACAGGACGGCAGCAGCTACCGGCGGCCCCTGGAGCAGCAGCAGCCTCACCACATCCCGACCAGTGCCCCGGTTTACCAGCAGCCCCAGCAGCAGCCGGTGGCCCAGTCCTATGGTGGCTACAAGGAGCCTGCAGCCCCAGTCTCCATACAGCGCAGCGCCCCAGGTGGTGGCGGGAAGCGGTACCGCGCGGTGTATGACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTGCAGCAGATCGACGACGGCTGGATGTACGGGACGGTGGAGCGCACCGGCGACACGGGGATGCTGCCGGCCAACTACGTGGAGGCCATCTGA |
ORF Protein Sequence | MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0191-Ab | Anti-LASP1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0191-Ag | LASP1 protein |
ORF Viral Vector | pGMLP004976 | Human LASP1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004976 | Human LASP1 Lentivirus particle |
Target information
Target ID | GM-IP0191 |
Target Name | LASP1 |
Gene ID | 3927, 16796, 694950, 29278, 101088284, 608624, 532851, 100068429 |
Gene Symbol and Synonyms | Def-4,Lasp-1,LASP1,MLN 50,MLN50,SH3P6,Tg(Col1a1-lacZ)1Ngma |
Uniprot Accession | Q14847 |
Uniprot Entry Name | LASP1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000002834 |
Target Classification | Not Available |
This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.