Human INSL6/RIF1 ORF/cDNA clone-Lentivirus plasmid (NM_007179)

Cat. No.: pGMLP005079
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human INSL6/RIF1 Lentiviral expression plasmid for INSL6 lentivirus packaging, INSL6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to INSL6/RIF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $460.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005079
Gene Name INSL6
Accession Number NM_007179
Gene ID 11172
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 642 bp
Gene Alias RIF1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGCGGCTCCTCCGCTTGTCCCTGCTGTGGCTTGGACTCCTGCTGGTTCGGTTTTCTCGTGAACTGAGCGACATCAGCAGTGCCAGGAAGCTGTGCGGCAGGTACTTGGTGAAAGAAATAGAAAAACTCTGCGGCCATGCCAACTGGAGCCAGTTCCGTTTCGAGGAGGAAACCCCTTTCTCACGGTTGATTGCACAGGCCTCGGAGAAGGTCGAAGCCTACAGCCCATACCAGTTCGAAAGCCCGCAAACCGCTTCCCCGGCCCGGGGAAGAGGCACAAACCCAGTGTCTACTTCTTGGGAAGAAGCAGTAAACAGTTGGGAAATGCAGTCACTACCTGAGTATAAGGATAAAAAGGGATATTCACCCCTTGGTAAGACAAGAGAATTTTCTTCATCACATAATATCAATGTATATATTCATGAGAATGCAAAATTTCAGAAGAAACGTAGAAACAAAATTAAAACCTTAAGCAATTTGTTTTGGGGGCATCATCCCCAAAGAAAACGCAGAGGATATTCAGAAAAGTGTTGTCTTACAGGATGTACAAAAGAAGAACTTAGCATTGCATGTCTTCCATATATTGATTTTAAAAGGCTAAAGGAAAAAAGATCATCACTTGTAACTAAGATATACTAA
ORF Protein Sequence MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1037-Ab Anti-INSL6/ RIF1 functional antibody
    Target Antigen GM-Tg-g-SE1037-Ag INSL6 protein
    ORF Viral Vector pGMLP005079 Human INSL6 Lentivirus plasmid
    ORF Viral Vector vGMLP005079 Human INSL6 Lentivirus particle


    Target information

    Target ID GM-SE1037
    Target Name INSL6
    Gene ID 11172, 27356, 693735, 50546, 101088698, 476343, 100146379
    Gene Symbol and Synonyms INSL6,RIF1
    Uniprot Accession Q9Y581
    Uniprot Entry Name INSL6_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000120210
    Target Classification Not Available

    The protein encoded by this gene contains a classical signature of the insulin superfamily and is significantly similar to relaxin and relaxin-like factor. This gene is preferentially expressed in testis. Its expression in testis is restricted to interstitial cells surrounding seminiferous tubules, which suggests a role in sperm development and fertilization. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.