Human PCOLCE/PCPE/PCPE-1 ORF/cDNA clone-Lentivirus plasmid (NM_002593)

Cat. No.: pGMLP005093
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PCOLCE/PCPE/PCPE-1 Lentiviral expression plasmid for PCOLCE lentivirus packaging, PCOLCE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PCOLCE/PCPE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $678
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005093
Gene Name PCOLCE
Accession Number NM_002593
Gene ID 5118
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1350 bp
Gene Alias PCPE,PCPE-1,PCPE1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCCTGCAGCCACAGCCTCCCTCCTGGGGCCCCTCCTCACTGCCTGCGCCCTGCTGCCTTTTGCCCAGGGCCAGACCCCCAACTACACCAGACCCGTGTTCCTGTGCGGAGGGGATGTGAAGGGGGAATCAGGTTACGTGGCAAGTGAGGGGTTCCCCAACCTCTACCCCCCTAATAAGGAGTGCATCTGGACCATAACGGTCCCCGAGGGCCAGACTGTGTCCCTCTCATTCCGAGTCTTCGACCTGGAGCTGCACCCCGCCTGCCGCTACGATGCTCTGGAGGTCTTCGCTGGGTCTGGGACTTCCGGCCAGCGGCTCGGACGCTTTTGTGGGACCTTCCGGCCTGCGCCCCTAGTCGCCCCCGGCAACCAGGTGACCCTGAGGATGACGACGGATGAGGGCACAGGAGGACGAGGCTTCCTGCTCTGGTACAGCGGGCGGGCCACCTCGGGCACTGAGCACCAATTTTGCGGGGGGCGGCTGGAGAAGGCCCAGGGAACCCTGACCACGCCCAACTGGCCCGAGTCCGATTACCCCCCGGGCATCAGCTGTTCCTGGCACATCATCGCGCCCCCGGACCAGGTCATCGCGCTGACCTTCGAGAAGTTTGACCTGGAGCCGGACACCTACTGCCGCTATGACTCGGTCAGCGTGTTCAACGGAGCCGTGAGCGACGACTCCCGGAGGCTGGGGAAGTTCTGCGGCGACGCAGTCCCGGGCTCCATCTCCTCCGAAGGGAATGAACTCCTCGTCCAGTTCGTCTCAGATCTCAGTGTCACCGCTGATGGCTTCTCAGCCTCCTACAAGACCCTGCCGCGGGGCACTGCCAAAGAAGGGCAAGGGCCCGGCCCCAAACGGGGAACTGAGCCTAAAGTCAAGCTGCCCCCCAAGTCCCAACCTCCGGAGAAAACAGAGGAATCTCCTTCAGCCCCTGATGCACCCACCTGCCCAAAGCAGTGCCGCCGGACAGGCACCTTGCAGAGCAACTTCTGTGCCAGCAGCCTTGTGGTGACTGCGACAGTGAAGTCCATGGTTCGGGAGCCAGGGGAGGGCCTTGCCGTGACTGTCAGTCTTATTGGTGCTTATAAAACTGGAGGACTGGACCTGCCTTCTCCACCCACTGGTGCCTCCCTGAAGTTTTACGTGCCTTGCAAGCAGTGCCCCCCCATGAAGAAAGGAGTCAGTTATCTGCTGATGGGCCAGGTAGAAGAGAACAGAGGCCCCGTCCTTCCTCCAGAGAGCTTTGTGGTTCTCCACCGGCCCAACCAGGACCAGATCCTCACCAACCTAAGCAAGAGGAAGTGCCCCTCTCAACCTGTGCGGGCTGCTGCGTCCCAGGACTGA
ORF Protein Sequence MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1174-Ab Anti-PCOC1/ PCOLCE/ PCPE functional antibody
    Target Antigen GM-Tg-g-SE1174-Ag PCOLCE protein
    ORF Viral Vector pGMLP005093 Human PCOLCE Lentivirus plasmid
    ORF Viral Vector vGMLP005093 Human PCOLCE Lentivirus particle


    Target information

    Target ID GM-SE1174
    Target Name PCOLCE
    Gene ID 5118, 18542, 712496, 29569, 101091986, 489835, 504471, 100067418
    Gene Symbol and Synonyms Astt-2,Astt2,P14,PCOLCE,PCPE,PCPE-1,PCPE1
    Uniprot Accession Q15113
    Uniprot Entry Name PCOC1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000106333
    Target Classification Not Available

    Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.