Human CRLS1/C20orf155/CLS ORF/cDNA clone-Lentivirus plasmid (NM_019095)

Cat. No.: pGMLP005143
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRLS1/C20orf155/CLS Lentiviral expression plasmid for CRLS1 lentivirus packaging, CRLS1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CRLS1/C20orf155 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $526.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005143
Gene Name CRLS1
Accession Number NM_019095
Gene ID 54675
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 906 bp
Gene Alias C20orf155,CLS,CLS1,dJ967N21.6,GCD10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTAGCCTTGCGCGTGGCGCGCGGCTCGTGGGGGGCCCTGCGCGGCGCCGCTTGGGCTCCGGGAACGCGGCCGAGTAAGCGACGCGCCTGCTGGGCCCTGCTGCCGCCCGTGCCCTGCTGCTTGGGCTGCCTGGCCGAACGCTGGAGGCTGCGTCCGGCCGCTCTTGGCTTGCGGCTGCCCGGGATCGGCCAGCGGAACCACTGTTCGGGCGCGGGGAAGGCGGCTCCCAGGCCAGCGGCCGGAGCGGGCGCCGCTGCCGAAGCCCCGGGCGGCCAGTGGGGCCCGGCGAGCACCCCCAGCCTGTATGAAAACCCATGGACAATCCCGAATATGTTGTCAATGACGAGAATTGGCTTGGCCCCAGTTCTGGGCTATTTGATTATTGAAGAAGATTTTAATATTGCACTAGGAGTTTTTGCTTTAGCTGGACTAACAGATTTGTTGGATGGATTTATTGCTCGAAACTGGGCCAATCAAAGATCAGCTTTGGGAAGTGCTCTTGATCCACTTGCTGATAAAATACTTATCAGTATCTTATATGTTAGCTTGACCTATGCAGATCTTATTCCAGTTCCACTTACTTACATGATCATTTCGAGAGATGTAATGTTGATTGCTGCTGTTTTTTATGTCAGATACCGAACTCTTCCAACACCACGAACACTTGCCAAGTATTTCAATCCTTGCTATGCCACTGCTAGGTTAAAACCAACATTCATCAGCAAGGTGAATACAGCAGTCCAGTTAATCTTGGTGGCAGCTTCTTTGGCAGCTCCAGTTTTCAACTATGCTGACAGCATTTATCTTCAGATACTATGGTGTTTTACAGCTTTCACCACAGCTGCATCAGCTTATAGTTACTATCATTATGGCCGGAAGACTGTTCAGGTGATAAAAGACTGA
ORF Protein Sequence MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0615-Ab Anti-CRLS1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0615-Ag CRLS1 protein
    ORF Viral Vector pGMLP005143 Human CRLS1 Lentivirus plasmid
    ORF Viral Vector vGMLP005143 Human CRLS1 Lentivirus particle


    Target information

    Target ID GM-IP0615
    Target Name CRLS1
    Gene ID 54675, 66586, 718265, 366196, 101081971, 607530, 512761, 100065537
    Gene Symbol and Synonyms 0610009I22Rik,4930557M15Rik,5730490M08Rik,C20orf155,CLS,CLS1,COSPD57,CRLS1,dJ967N21.6,GCD10,RGD1311037
    Uniprot Accession Q9UJA2
    Uniprot Entry Name CRLS1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000088766
    Target Classification Not Available

    This gene encodes a member of the CDP-alcohol phosphatidyltransferase class-I family of proteins. The encoded enzyme catalyzes the synthesis of cardiolipin, a phospholipid component of mitochondrial membranes that is critical for mitochondrial function. [provided by RefSeq, Apr 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.