Human TRIB2/C5FW/GS3955 ORF/cDNA clone-Lentivirus plasmid (NM_021643.3)
Cat. No.: pGMLP005250
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TRIB2/C5FW/GS3955 Lentiviral expression plasmid for TRIB2 lentivirus packaging, TRIB2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TRIB2/C5FW products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005250 |
Gene Name | TRIB2 |
Accession Number | NM_021643.3 |
Gene ID | 28951 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1032 bp |
Gene Alias | C5FW,GS3955,TRB2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAACATACACAGGTCTACCCCCATCACAATAGCGAGATATGGGAGATCGCGGAACAAAACCCAGGATTTCGAAGAGTTGTCGTCTATAAGGTCCGCGGAGCCCAGCCAGAGTTTCAGCCCGAACCTCGGCTCCCCGAGCCCGCCCGAGACTCCGAACTTGTCGCATTGCGTTTCTTGTATCGGGAAATACTTATTGTTGGAACCTCTGGAGGGAGACCACGTTTTTCGTGCCGTGCATCTGCACAGCGGAGAGGAGCTGGTGTGCAAGGTGTTTGATATCAGCTGCTACCAGGAATCCCTGGCACCGTGCTTTTGCCTGTCTGCTCATAGTAACATCAACCAAATCACTGAAATTATCCTGGGTGAGACCAAAGCCTATGTGTTCTTTGAGCGAAGCTATGGGGACATGCATTCCTTCGTCCGCACCTGCAAGAAGCTGAGAGAGGAGGAGGCAGCCAGACTGTTCTACCAGATTGCCTCGGCAGTGGCCCACTGCCATGACGGGGGGCTGGTGCTGCGGGACCTCAAGCTGCGGAAATTCATCTTTAAGGACGAAGAGAGGACTCGGGTCAAGCTGGAAAGCCTGGAAGACGCCTACATTCTGCGGGGAGATGATGATTCCCTCTCCGACAAGCATGGCTGCCCGGCTTACGTAAGCCCAGAGATCTTGAACACCAGTGGCAGCTACTCGGGCAAAGCAGCCGACGTGTGGAGCCTGGGGGTGATGCTGTACACCATGTTGGTGGGGCGGTACCCTTTCCATGACATTGAACCCAGCTCCCTCTTCAGCAAGATCCGGCGTGGCCAGTTCAACATTCCAGAGACTCTGTCGCCCAAGGCCAAGTGCCTCATCCGAAGCATTCTGCGTCGGGAGCCCTCAGAGCGGCTGACCTCGCAGGAAATTCTGGACCATCCTTGGTTTTCTACAGATTTTAGCGTCTCGAATTCAGCATATGGTGCTAAGGAAGTGTCTGACCAGCTGGTGCCGGACGTCAACATGGAAGAGAACTTGGACCCTTTCTTTAACTGA |
ORF Protein Sequence | MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2175-Ab | Anti-TRIB2 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2175-Ag | TRIB2 protein |
ORF Viral Vector | pGMLP005250 | Human TRIB2 Lentivirus plasmid |
ORF Viral Vector | vGMLP005250 | Human TRIB2 Lentivirus particle |
Target information
Target ID | GM-IP2175 |
Target Name | TRIB2 |
Gene ID | 28951, 217410, 710966, 313974, 101085367, 403884, 352960, 100056836 |
Gene Symbol and Synonyms | C5FW,GS3955,RGD1564451,TRB-2,TRB2,TRIB2 |
Uniprot Accession | Q92519 |
Uniprot Entry Name | TRIB2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000071575 |
Target Classification | Not Available |
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.