Human CKB/B-CK/BCK ORF/cDNA clone-Lentivirus plasmid (NM_001823.4)

Cat. No.: pGMLP005415
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CKB/B-CK/BCK Lentiviral expression plasmid for CKB lentivirus packaging, CKB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CKB/B-CK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $620.88
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005415
Gene Name CKB
Accession Number NM_001823.4
Gene ID 1152
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1146 bp
Gene Alias B-CK,BCK,CKBB,CPK-B,HEL-211,HEL-S-29
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCTTCTCCAACAGCCACAACGCACTGAAGCTGCGCTTCCCGGCCGAGGACGAGTTCCCCGACCTGAGCGCCCACAACAACCACATGGCCAAGGTGCTGACCCCCGAGCTGTACGCGGAGCTGCGCGCCAAGAGCACGCCGAGCGGCTTCACGCTGGACGACGTCATCCAGACAGGCGTGGACAACCCGGGCCACCCGTACATCATGACCGTGGGCTGCGTGGCGGGCGACGAGGAGTCCTACGAAGTGTTCAAGGATCTCTTCGACCCCATCATCGAGGACCGGCACGGCGGCTACAAGCCCAGCGATGAGCACAAGACCGACCTCAACCCCGACAACCTGCAGGGCGGCGACGACCTGGACCCCAACTACGTGCTGAGCTCGCGGGTGCGCACGGGCCGCAGCATCCGTGGCTTCTGCCTCCCCCCGCACTGCAGCCGCGGGGAGCGCCGCGCCATCGAGAAGCTCGCGGTGGAAGCCCTGTCCAGCCTGGACGGCGACCTGGCGGGCCGATACTACGCGCTCAAGAGCATGACGGAGGCGGAGCAGCAGCAGCTCATCGACGACCACTTCCTCTTCGACAAGCCCGTGTCGCCCCTGCTGCTGGCCTCGGGCATGGCCCGCGACTGGCCCGACGCCCGCGGTATCTGGCACAATGACAATAAGACCTTCCTGGTGTGGGTCAACGAGGAGGACCACCTGCGGGTCATCTCCATGCAGAAGGGGGGCAACATGAAGGAGGTGTTCACCCGCTTCTGCACCGGCCTCACCCAGATTGAAACTCTCTTCAAGTCTAAGGACTATGAGTTCATGTGGAACCCTCACCTGGGCTACATCCTCACCTGCCCATCCAACCTGGGCACCGGGCTGCGGGCAGGTGTGCATATCAAGCTGCCCAACCTGGGCAAGCATGAGAAGTTCTCGGAGGTGCTTAAGCGGCTGCGACTTCAGAAGCGAGGCACAGGCGGTGTGGACACGGCTGCGGTGGGCGGGGTCTTCGACGTCTCCAACGCTGACCGCCTGGGCTTCTCAGAGGTGGAGCTGGTGCAGATGGTGGTGGACGGAGTGAAGCTGCTCATCGAGATGGAGCAGCGGCTGGAGCAGGGCCAGGCCATCGACGACCTCATGCCTGCCCAGAAATGA
ORF Protein Sequence MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA005-Ab Anti-CKB monoclonal antibody
    Target Antigen GM-Tg-g-TA005-Ag CKB protein
    ORF Viral Vector pGMLP005415 Human CKB Lentivirus plasmid
    ORF Viral Vector vGMLP005415 Human CKB Lentivirus particle


    Target information

    Target ID GM-TA005
    Target Name CKB
    Gene ID 1152, 12709, 711167, 24264, 101098237, 516210, 100055201
    Gene Symbol and Synonyms B-CK,BCK,Ck-3,Ck3,CKB,CKBB,Ckbr,CPK-B,HEL-211,HEL-S-29
    Uniprot Accession P12277
    Uniprot Entry Name KCRB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Lung Cancer, Heart failure, Congenital occlusion of ureteropelvic junction
    Gene Ensembl ENSG00000166165
    Target Classification Not Available

    The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.