Human CKB/B-CK/BCK ORF/cDNA clone-Lentivirus plasmid (NM_001823.4)
Cat. No.: pGMLP005415
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CKB/B-CK/BCK Lentiviral expression plasmid for CKB lentivirus packaging, CKB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CKB/B-CK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005415 |
Gene Name | CKB |
Accession Number | NM_001823.4 |
Gene ID | 1152 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1146 bp |
Gene Alias | B-CK,BCK,CKBB,CPK-B,HEL-211,HEL-S-29 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCCTTCTCCAACAGCCACAACGCACTGAAGCTGCGCTTCCCGGCCGAGGACGAGTTCCCCGACCTGAGCGCCCACAACAACCACATGGCCAAGGTGCTGACCCCCGAGCTGTACGCGGAGCTGCGCGCCAAGAGCACGCCGAGCGGCTTCACGCTGGACGACGTCATCCAGACAGGCGTGGACAACCCGGGCCACCCGTACATCATGACCGTGGGCTGCGTGGCGGGCGACGAGGAGTCCTACGAAGTGTTCAAGGATCTCTTCGACCCCATCATCGAGGACCGGCACGGCGGCTACAAGCCCAGCGATGAGCACAAGACCGACCTCAACCCCGACAACCTGCAGGGCGGCGACGACCTGGACCCCAACTACGTGCTGAGCTCGCGGGTGCGCACGGGCCGCAGCATCCGTGGCTTCTGCCTCCCCCCGCACTGCAGCCGCGGGGAGCGCCGCGCCATCGAGAAGCTCGCGGTGGAAGCCCTGTCCAGCCTGGACGGCGACCTGGCGGGCCGATACTACGCGCTCAAGAGCATGACGGAGGCGGAGCAGCAGCAGCTCATCGACGACCACTTCCTCTTCGACAAGCCCGTGTCGCCCCTGCTGCTGGCCTCGGGCATGGCCCGCGACTGGCCCGACGCCCGCGGTATCTGGCACAATGACAATAAGACCTTCCTGGTGTGGGTCAACGAGGAGGACCACCTGCGGGTCATCTCCATGCAGAAGGGGGGCAACATGAAGGAGGTGTTCACCCGCTTCTGCACCGGCCTCACCCAGATTGAAACTCTCTTCAAGTCTAAGGACTATGAGTTCATGTGGAACCCTCACCTGGGCTACATCCTCACCTGCCCATCCAACCTGGGCACCGGGCTGCGGGCAGGTGTGCATATCAAGCTGCCCAACCTGGGCAAGCATGAGAAGTTCTCGGAGGTGCTTAAGCGGCTGCGACTTCAGAAGCGAGGCACAGGCGGTGTGGACACGGCTGCGGTGGGCGGGGTCTTCGACGTCTCCAACGCTGACCGCCTGGGCTTCTCAGAGGTGGAGCTGGTGCAGATGGTGGTGGACGGAGTGAAGCTGCTCATCGAGATGGAGCAGCGGCTGGAGCAGGGCCAGGCCATCGACGACCTCATGCCTGCCCAGAAATGA |
ORF Protein Sequence | MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA005-Ab | Anti-CKB monoclonal antibody |
Target Antigen | GM-Tg-g-TA005-Ag | CKB protein |
ORF Viral Vector | pGMLP005415 | Human CKB Lentivirus plasmid |
ORF Viral Vector | vGMLP005415 | Human CKB Lentivirus particle |
Target information
Target ID | GM-TA005 |
Target Name | CKB |
Gene ID | 1152, 12709, 711167, 24264, 101098237, 516210, 100055201 |
Gene Symbol and Synonyms | B-CK,BCK,Ck-3,Ck3,CKB,CKBB,Ckbr,CPK-B,HEL-211,HEL-S-29 |
Uniprot Accession | P12277 |
Uniprot Entry Name | KCRB_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Lung Cancer, Heart failure, Congenital occlusion of ureteropelvic junction |
Gene Ensembl | ENSG00000166165 |
Target Classification | Not Available |
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.