Human PGAM5/BXLBV68 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001170543)

Cat. No.: pGMPC000103
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PGAM5/BXLBV68 Non-Viral expression plasmid (overexpression vector) for mouse PGAM5 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to PGAM5/BXLBV68 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000103
Gene Name PGAM5
Accession Number NM_001170543
Gene ID 192111
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 870 bp
Gene Alias BXLBV68
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTCCGGCAGGCGCTGCAGCTGGCGGCCTGCGGGCTGGCCGGGGGCTCGGCCGCCGTGCTCTTCTCGGCCGTGGCGGTAGGGAAGCCGCGCGCAGGCGGGGACGCGGAGCCACGCCCGGCTGAGCCGCCGGCCTGGGCGGGGGGCGCGCGGCCGGGCCCCGGTGTCTGGGACCCCAACTGGGACAGGCGAGAACCACTGTCTCTGATCAACGTGCGGAAGAGGAACGTGGAATCTGGGGAAGAAGAGCTGGCGTCCAAGCTGGACCACTACAAAGCCAAGGCCACGCGGCACATCTTCCTCATCAGGCATTCCCAGTACCACGTGGATGGCTCCCTGGAGAAGGACCGCACTCTGACCCCGCTGGGTCGGGAGCAGGCTGAACTCACTGGGCTCCGCCTGGCAAGCTTGGGGTTGAAGTTTAATAAAATCGTCCATTCGTCTATGACGCGCGCCATAGAGACCACCGATATCATCAGCCGGCACCTGCCAGGCGTCTGCAAAGTCAGCACAGATCTGCTGCGGGAAGGCGCCCCCATCGAGCCAGACCCGCCCGTGTCTCATTGGAAGCCGGAAGCTGTGCAGTATTACGAAGACGGAGCCCGGATCGAGGCCGCCTTCCGGAACTACATCCACCGCGCAGATGCCAGGCAGGAGGAGGACAGTTACGAGATCTTCATCTGTCACGCCAACGTCATCCGCTACATCGTGTGCAGAGCACTGCAGTTTCCTCCTGAAGGCTGGCTCCGGCTCTCCCTCAATAATGGCAGCATCACCCACCTGGTGATCCGACCCAACGGCCGAGTTGCGCTCAGGACCCTCGGGGACACGGGGTTCATGCCTCCCGACAAGATCACTCGATCCTGA
ORF Protein Sequence MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0403-Ab Anti-PGAM5/ BXLBV68 functional antibody
    Target Antigen GM-Tg-g-SE0403-Ag PGAM5 protein
    ORF Viral Vector pGMLP004849 Human PGAM5 Lentivirus plasmid
    ORF Viral Vector pGMAAV000953 Human PGAM5 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000103 Human PGAM5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004849 Human PGAM5 Lentivirus particle
    ORF Viral Vector vGMAAV000953 Human PGAM5 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0403
    Target Name PGAM5
    Gene ID 192111, 72542, 693782, 288731, 101096675, 486221, 508608, 100630108
    Gene Symbol and Synonyms 2610528A17Rik,BXLBV68,PGAM5,RGD1312028
    Uniprot Accession Q96HS1
    Uniprot Entry Name PGAM5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000247077
    Target Classification Not Available

    Enables GTPase activator activity and protein serine/threonine phosphatase activity. Involved in necroptotic process. Located in mitochondrion. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.