Human CDKN2C /INK4C/p18 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001262)

Cat. No.: pGMPC000240
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDKN2C /INK4C/p18 Non-Viral expression plasmid (overexpression vector) for mouse CDKN2C overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to CDKN2C/CDKN2C /INK4C products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000240
Gene Name CDKN2C
Accession Number NM_001262
Gene ID 1031
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 507 bp
Gene Alias INK4C,p18,p18-INK4C
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGCCTTGGGGGAACGAGTTGGCGTCCGCAGCTGCCAGGGGGGACCTAGAGCAACTTACTAGTTTGTTGCAAAATAATGTAAACGTCAATGCACAAAATGGATTTGGAAGGACTGCGCTGCAGGTTATGAAACTTGGAAATCCCGAGATTGCCAGGAGACTGCTACTTAGAGGTGCTAATCCCGATTTGAAAGACCGAACTGGTTTCGCTGTCATTCATGATGCGGCCAGAGCAGGTTTCCTGGACACTTTACAGACTTTGCTGGAGTTTCAAGCTGATGTTAACATCGAGGATAATGAAGGGAACCTGCCCTTGCACTTGGCTGCCAAAGAAGGCCACCTCCGGGTGGTGGAGTTCCTGGTGAAGCACACGGCCAGCAATGTGGGGCATCGGAACCATAAGGGGGACACCGCCTGTGATTTGGCCAGGCTCTATGGGAGGAATGAGGTTGTTAGCCTGATGCAGGCAAACGGGGCTGGGGGAGCCACAAATCTTCAATAA
ORF Protein Sequence MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45755-Ab Anti-CDKN2C monoclonal antibody
    Target Antigen GM-Tg-g-T45755-Ag CDKN2C protein
    ORF Viral Vector pGMLP000162 Human CDKN2C Lentivirus plasmid
    ORF Viral Vector pGMPC000240 Human CDKN2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000162 Human CDKN2C Lentivirus particle


    Target information

    Target ID GM-T45755
    Target Name CDKN2C
    Gene ID 1031, 12580, 711877, 54238, 101086582, 475359, 505691, 100051195
    Gene Symbol and Synonyms CDKN2C,INK4C,p18,p18-INK4C,p18-INK6,p18INK4c
    Uniprot Accession P42773
    Uniprot Entry Name CDN2C_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000123080
    Target Classification Not Available

    The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.