Human CDKN2C /INK4C/p18 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001262)
Cat. No.: pGMPC000240
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CDKN2C /INK4C/p18 Non-Viral expression plasmid (overexpression vector) for mouse CDKN2C overexpression in unique cell transient transfection and stable cell line development.
Go to
CDKN2C/CDKN2C /INK4C products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC000240 |
Gene Name | CDKN2C |
Accession Number | NM_001262 |
Gene ID | 1031 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 507 bp |
Gene Alias | INK4C,p18,p18-INK4C |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGAGCCTTGGGGGAACGAGTTGGCGTCCGCAGCTGCCAGGGGGGACCTAGAGCAACTTACTAGTTTGTTGCAAAATAATGTAAACGTCAATGCACAAAATGGATTTGGAAGGACTGCGCTGCAGGTTATGAAACTTGGAAATCCCGAGATTGCCAGGAGACTGCTACTTAGAGGTGCTAATCCCGATTTGAAAGACCGAACTGGTTTCGCTGTCATTCATGATGCGGCCAGAGCAGGTTTCCTGGACACTTTACAGACTTTGCTGGAGTTTCAAGCTGATGTTAACATCGAGGATAATGAAGGGAACCTGCCCTTGCACTTGGCTGCCAAAGAAGGCCACCTCCGGGTGGTGGAGTTCCTGGTGAAGCACACGGCCAGCAATGTGGGGCATCGGAACCATAAGGGGGACACCGCCTGTGATTTGGCCAGGCTCTATGGGAGGAATGAGGTTGTTAGCCTGATGCAGGCAAACGGGGCTGGGGGAGCCACAAATCTTCAATAA |
ORF Protein Sequence | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T45755-Ab | Anti-CDKN2C monoclonal antibody |
Target Antigen | GM-Tg-g-T45755-Ag | CDKN2C protein |
ORF Viral Vector | pGMLP000162 | Human CDKN2C Lentivirus plasmid |
ORF Viral Vector | pGMPC000240 | Human CDKN2C Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000162 | Human CDKN2C Lentivirus particle |
Target information
Target ID | GM-T45755 |
Target Name | CDKN2C |
Gene ID | 1031, 12580, 711877, 54238, 101086582, 475359, 505691, 100051195 |
Gene Symbol and Synonyms | CDKN2C,INK4C,p18,p18-INK4C,p18-INK6,p18INK4c |
Uniprot Accession | P42773 |
Uniprot Entry Name | CDN2C_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000123080 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.