Human SLC25A51/CG7943/MCART1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_033412.4)

Cat. No.: pGMPC000546
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC25A51/CG7943/MCART1 Non-Viral expression plasmid (overexpression vector) for mouse SLC25A51 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SLC25A51/CG7943 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000546
Gene Name SLC25A51
Accession Number NM_033412.4
Gene ID 92014
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 894 bp
Gene Alias CG7943,MCART1
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGGATTCAGAAGCTCATGAAAAGAGGCCACCAATACTAACATCTTCAAAACAAGATATATCACCTCATATTACAAATGTTGGTGAGATGAAGCATTACTTGTGTGGCTGCTGTGCAGCCTTCAACAATGTCGCAATCACATTTCCCATTCAGAAGGTCCTCTTTCGACAACAGCTGTATGGCATCAAAACCCGGGATGCAATACTTCAGTTGAGAAGGGATGGATTTCGAAATTTGTATCGTGGAATCCTTCCCCCATTGATGCAGAAGACAACTACGCTTGCACTTATGTTTGGTCTGTATGAGGATTTATCCTGCCTTCTCCACAAGCATGTCAGTGCTCCAGAGTTTGCAACCAGTGGCGTGGCGGCAGTGCTTGCAGGGACAACAGAAGCAATTTTCACTCCACTGGAAAGAGTTCAGACATTGCTTCAAGACCACAAGCATCATGACAAATTTACCAACACTTACCAGGCTTTCAAGGCACTGAAATGTCATGGAATTGGAGAGTATTATCGAGGCTTGGTGCCCATTCTTTTCCGGAATGGACTCAGCAATGTCTTGTTTTTCGGCCTTCGAGGTCCCATTAAGGAGCATCTGCCTACCGCAACGACTCACAGTGCTCATCTGGTCAATGATTTTATCTGTGGAGGTCTATTGGGTGCCATGTTGGGATTCTTGTTTTTTCCAATTAATGTTGTAAAAACTCGCATACAGTCTCAGATTGGTGGGGAATTTCAGTCTTTCCCCAAGGTTTTCCAAAAAATCTGGCTGGAACGGGACAGAAAACTGATAAATCTTTTCAGAGGTGCCCATCTGAATTACCATCGGTCCCTCATCTCTTGGGGCATAATCAATGCAACTTATGAGTTCTTGTTAAAGGTTATATGA
ORF Protein Sequence MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1689-Ab Anti-SLC25A51 monoclonal antibody
    Target Antigen GM-Tg-g-IP1689-Ag SLC25A51 protein
    ORF Viral Vector pGMPC000546 Human SLC25A51 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP1689
    Target Name SLC25A51
    Gene ID 92014, 230125, 716206, 313241, 101081580, 100686420, 781425, 100066182
    Gene Symbol and Synonyms 9130208E07Rik,CG7943,D130005A03Rik,Gm138,MCART1,SLC25A51
    Uniprot Accession Q9H1U9
    Uniprot Entry Name S2551_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000122696
    Target Classification Not Available

    Enables NAD transmembrane transporter activity. Involved in mitochondrial NAD transmembrane transport. Located in mitochondrion. Is active in mitochondrial inner membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.