Human CEBPB/C/EBP-beta/IL6DBP ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_005194.3)

Cat. No.: pGMPC000969
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CEBPB/C/EBP-beta/IL6DBP Non-Viral expression plasmid (overexpression vector) for mouse CEBPB overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to CEBPB/C/EBP-beta products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000969
Gene Name CEBPB
Accession Number NM_005194.3
Gene ID 1051
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1038 bp
Gene Alias C/EBP-beta,IL6DBP,NF-IL6,TCF5
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAACGCCTGGTGGCCTGGGACCCAGCATGTCTCCCCCTGCCGCCGCCGCCGCCTGCCTTTAAATCCATGGAAGTGGCCAACTTCTACTACGAGGCGGACTGCTTGGCTGCTGCGTACGGCGGCAAGGCGGCCCCCGCGGCGCCCCCCGCGGCCAGACCCGGGCCGCGCCCCCCCGCCGGCGAGCTGGGCAGCATCGGCGACCACGAGCGCGCCATCGACTTCAGCCCGTACCTGGAGCCGCTGGGCGCGCCGCAGGCCCCGGCGCCCGCCACGGCCACGGACACCTTCGAGGCGGCTCCGCCCGCGCCCGCCCCCGCGCCCGCCTCCTCCGGGCAGCACCACGACTTCCTCTCCGACCTCTTCTCCGACGACTACGGGGGCAAGAACTGCAAGAAGCCGGCCGAGTACGGCTACGTGAGCCTGGGGCGCCTGGGGGCCGCCAAGGGCGCGCTGCACCCCGGCTGCTTCGCGCCCCTGCACCCACCGCCCCCGCCGCCGCCGCCGCCCGCCGAGCTCAAGGCGGAGCCGGGCTTCGAGCCCGCGGACTGCAAGCGGAAGGAGGAGGCCGGGGCGCCGGGCGGCGGCGCAGGCATGGCGGCGGGCTTCCCGTACGCGCTGCGCGCTTACCTCGGCTACCAGGCGGTGCCGAGCGGCAGCAGCGGGAGCCTCTCCACGTCCTCCTCGTCCAGCCCGCCCGGCACGCCGAGCCCCGCTGACGCCAAGGCGCCCCCGACCGCCTGCTACGCGGGGGCCGCGCCGGCGCCCTCGCAGGTCAAGAGCAAGGCCAAGAAGACCGTGGACAAGCACAGCGACGAGTACAAGATCCGGCGCGAGCGCAACAACATCGCCGTGCGCAAGAGCCGCGACAAGGCCAAGATGCGCAACCTGGAGACGCAGCACAAGGTCCTGGAGCTCACGGCCGAGAACGAGCGGCTGCAGAAGAAGGTGGAGCAGCTGTCGCGCGAGCTCAGCACCCTGCGGAACTTGTTCAAGCAGCTGCCCGAGCCCCTGCTCGCCTCCTCCGGCCACTGCTAG
ORF Protein Sequence MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T51734-Ab Anti-CEBPB monoclonal antibody
    Target Antigen GM-Tg-g-T51734-Ag CEBPB protein
    ORF Viral Vector pGMLP-SPh-127 Human CEBPB Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-267 Human CEBPB Adenovirus plasmid
    ORF Viral Vector pGMPC000468 Human CEBPB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000779 Human CEBPB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000969 Human CEBPB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001782 Human CEBPB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP-SPh-127 Human CEBPB Lentivirus particle
    ORF Viral Vector vGMAP-SPh-267 Human CEBPB Adenovirus particle


    Target information

    Target ID GM-T51734
    Target Name CEBPB
    Gene ID 1051, 12608, 713191, 24253, 100144613, 100856480, 338319, 100071474
    Gene Symbol and Synonyms C/EBP-beta,C/EBPbeta,CEBPB,CRP2,IL-6DBP,IL6DBP,LAP,LIP,NF-IL6,NF-M,Nfil6,TCF5
    Uniprot Accession P17676
    Uniprot Entry Name CEBPB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000172216
    Target Classification Tumor-associated antigen (TAA)

    This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.