Human TFAP2A/AP-2/AP-2alpha ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001372066.1)

Cat. No.: pGMPC001244
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TFAP2A/AP-2/AP-2alpha Non-Viral expression plasmid (overexpression vector) for mouse TFAP2A overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to TFAP2A/AP-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001244
Gene Name TFAP2A
Accession Number NM_001372066.1
Gene ID 7020
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1320 bp
Gene Alias AP-2,AP-2alpha,AP2TF,BOFS,TFAP2
Fluorescent Reporter null
Mammalian Cell Selection Neomycin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAATGCTTTGGAAATTGACGGATAATATCAAGTACGAGGACTGCGAGGACCGTCACGACGGCACCAGCAACGGGACGGCACGGTTGCCCCAGCTGGGCACTGTAGGTCAATCTCCCTACACGAGCGCCCCGCCGCTGTCCCACACCCCCAATGCCGACTTCCAGCCCCCATACTTCCCCCCACCCTACCAGCCTATCTACCCCCAGTCGCAAGATCCTTACTCCCACGTCAACGACCCCTACAGCCTGAACCCCCTGCACGCCCAGCCGCAGCCGCAGCACCCAGGCTGGCCCGGCCAGAGGCAGAGCCAGGAGTCTGGGCTCCTGCACACGCACCGGGGGCTGCCTCACCAGCTGTCGGGCCTGGATCCTCGCAGGGACTACAGGCGGCACGAGGACCTCCTGCACGGCCCACACGCGCTCAGCTCAGGACTCGGAGACCTCTCGATCCACTCCTTACCTCACGCCATCGAGGAGGTCCCGCATGTAGAAGACCCGGGTATTAACATCCCAGATCAAACTGTAATTAAGAAAGGCCCCGTGTCCCTGTCCAAGTCCAACAGCAATGCCGTCTCCGCCATCCCTATTAACAAGGACAACCTCTTCGGCGGCGTGGTGAACCCCAACGAAGTCTTCTGTTCAGTTCCGGGTCGCCTCTCGCTCCTCAGCTCCACCTCGAAGTACAAGGTCACGGTGGCGGAAGTGCAGCGGCGGCTCTCACCACCCGAGTGTCTCAACGCGTCGCTGCTGGGCGGAGTGCTCCGGAGGGCGAAGTCTAAAAATGGAGGAAGATCTTTAAGAGAAAAACTGGACAAAATAGGATTAAATCTGCCTGCAGGGAGACGTAAAGCTGCCAACGTTACCCTGCTCACATCACTAGTAGAGGGAGAAGCTGTCCACCTAGCCAGGGACTTTGGGTACGTGTGCGAAACCGAATTTCCTGCCAAAGCAGTAGCTGAATTTCTCAACCGACAACATTCCGATCCCAATGAGCAAGTGACAAGAAAAAACATGCTCCTGGCTACAAAACAGATATGCAAAGAGTTCACCGACCTGCTGGCTCAGGACCGATCTCCCCTGGGGAACTCACGGCCCAACCCCATCCTGGAGCCCGGCATCCAGAGCTGCTTGACCCACTTCAACCTCATCTCCCACGGCTTCGGCAGCCCCGCGGTGTGTGCCGCGGTCACGGCCCTGCAGAACTATCTCACCGAGGCCCTCAAGGCCATGGACAAAATGTACCTCAGCAACAACCCCAACAGCCACACGGACAACAACGCCAAAAGCAGTGACAAAGAGGAGAAGCACAGAAAGTGA
ORF Protein Sequence MKMLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71317-Ab Anti-TFAP2A monoclonal antibody
    Target Antigen GM-Tg-g-T71317-Ag TFAP2A protein
    ORF Viral Vector pGMLV000890 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMLV001091 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMAP000248 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMAP000421 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMPC000285 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001244 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000890 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMLV001091 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMAP000248 Human TFAP2A Adenovirus particle
    ORF Viral Vector vGMAP000421 Human TFAP2A Adenovirus particle


    Target information

    Target ID GM-T71317
    Target Name TFAP2A
    Gene ID 7020, 21418, 700663, 306862, 101096393, 488213, 505849, 100063009
    Gene Symbol and Synonyms AP-2,Ap-2 (a),AP-2alpha,Ap2,AP2alpha,AP2TF,BOFS,Tcfap2a,TFAP2,TFAP2A
    Uniprot Accession P05549
    Uniprot Entry Name AP2A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000137203
    Target Classification Not Available

    The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.