Human SUMO3/SMT3A/Smt3B ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001286416.2)

Cat. No.: pGMPC001271
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SUMO3/SMT3A/Smt3B Non-Viral expression plasmid (overexpression vector) for mouse SUMO3 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SUMO3/SMT3A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001271
Gene Name SUMO3
Accession Number NM_001286416.2
Gene ID 6612
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 426 bp
Gene Alias SMT3A,Smt3B,SMT3H1,SUMO-3
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGAGGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAATGACCACATCAACCTGAAGGTGGCCGGGCAGGACGGCTCCGTGGTGCAGTTCAAGATCAAGAGGCACACGCCGCTGAGCAAGCTGATGAAGGCCTACTGCGAGAGGCAGGTGCGGCACCTTGCTCCCCCGCAGAGCCTCCCCGTGTGCGCACTGGTCCTGTGCGTTCCAGGCATCCCCAGAGCACGAGCGTCTCGGGGCTGGACCCAGATGCAGCTGCCCGAGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGACGGGCAGCCAATCAATGAAACTGACACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTGTGCCGGAGAGCAGCCTGGCAGGGCACAGTTTCTAG
ORF Protein Sequence MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQVRHLAPPQSLPVCALVLCVPGIPRARASRGWTQMQLPEGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA160-Ab Anti-SUMO3 monoclonal antibody
    Target Antigen GM-Tg-g-TA160-Ag SUMO3 protein
    ORF Viral Vector pGMPC000057 Human SUMO3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001271 Human SUMO3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001864 Human SUMO3 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-TA160
    Target Name SUMO3
    Gene ID 6612, 20610, 710764, 499417, 101087771, 100856530, 617236, 100630015
    Gene Symbol and Synonyms 2810014B19Rik,D10Ertd345e,SMT3A,Smt3B,SMT3H1,SUMO-3,SUMO3
    Uniprot Accession P55854
    Uniprot Entry Name SUMO3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000184900
    Target Classification Not Available

    This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.