Human LSMEM1/C7orf53 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_182597.3)

Cat. No.: pGMPC001628
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LSMEM1/C7orf53 Non-Viral expression plasmid (overexpression vector) for mouse LSMEM1 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LSMEM1/C7orf53 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001628
Gene Name LSMEM1
Accession Number NM_182597.3
Gene ID 286006
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 396 bp
Gene Alias C7orf53
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGACTCATTCTTCCCAGGACACTGGTTCTTGTGGCATTCAGGAAGATGGAAAGCTTTATGTGGTGGATTCCATAAATGACTTAAACAAACTAAACCTCTGTCCAGCCGGATCGCAGCATCTGTTCCCTCTAGAGGACAAAATCCCAGTCCTTGGCACAAACTCAGGAAATGGAAGCCGGAGTCTGTTTTTTGTGGGGCTGCTAATTGTGCTGATTGTCAGCCTGGCACTGGTTTTTTTCGTGATATTTCTAATAGTTCAAACTGGAAACAAGATGGATGATGTGTCAAGAAGACTAACAGCTGAAGGAAAAGACATAGATGATCTTAAGAGAATCAATAACATGATCGTAAAGCGACTCAACCAACTCAACCAACTGGACTCTGAACAAAACTAA
ORF Protein Sequence MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1128-Ab Anti-LSMEM1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1128-Ag LSMEM1 protein
    ORF Viral Vector pGMLP000254 Human LSMEM1 Lentivirus plasmid
    ORF Viral Vector pGMPC001628 Human LSMEM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000254 Human LSMEM1 Lentivirus particle


    Target information

    Target ID GM-IP1128
    Target Name LSMEM1
    Gene ID 286006, 380755, 702736, 680810, 101083329, 611967, 613798, 100630765
    Gene Symbol and Synonyms C14H7orf53,C4H7orf53,C7orf53,CA2H7orf53,Gm889,LSMEM1
    Uniprot Accession Q8N8F7
    Uniprot Entry Name LSME1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000181016
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.