Human AHSG/A2HS/AHS ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001622.4)

Cat. No.: pGMPC001767
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AHSG/A2HS/AHS Non-Viral expression plasmid (overexpression vector) for mouse AHSG overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to C-peptide/AHSG/A2HS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001767
Gene Name AHSG
Accession Number NM_001622.4
Gene ID 197
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1104 bp
Gene Alias A2HS,AHS,APMR1,FETUA,HSGA
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCCCTCGTCCTGCTCCTTTGTCTTGCTCAGCTCTGGGGCTGCCACTCAGCCCCACATGGCCCAGGGCTGATTTATAGACAACCGAACTGCGATGATCCAGAAACTGAGGAAGCAGCTCTGGTGGCTATAGACTACATCAATCAAAACCTTCCTTGGGGATACAAACACACCTTGAACCAGATTGATGAAGTAAAGGTGTGGCCTCAGCAGCCCTCCGGAGAGCTGTTTGAGATTGAAATAGACACCCTGGAAACCACCTGCCATGTGCTGGACCCCACCCCTGTGGCAAGATGCAGCGTGAGGCAGCTGAAGGAGCATGCTGTCGAAGGAGACTGTGATTTCCAGCTGTTGAAACTAGATGGCAAGTTTTCCGTGGTATACGCAAAATGTGATTCCAGTCCAGACTCAGCCGAGGACGTGCGCAAGGTGTGCCAAGACTGCCCCCTGCTGGCCCCGCTGAACGACACCAGGGTGGTGCACGCCGCGAAAGCTGCCCTGGCCGCCTTCAACGCTCAGAACAACGGCTCCAATTTTCAGCTGGAGGAAATTTCCCGGGCTCAGCTTGTGCCCCTCCCACCTTCTACCTATGTGGAGTTTACAGTGTCTGGCACTGACTGTGTTGCTAAAGAGGCCACAGAGGCAGCCAAGTGTAACCTGCTGGCAGAAAAGCAATATGGCTTTTGTAAGGCAACACTCAGTGAGAAGCTTGGTGGGGCAGAGGTTGCAGTGACCTGCATGGTGTTCCAAACACAGCCCGTGAGCTCACAGCCCCAACCAGAAGGTGCCAATGAAGCAGTCCCCACACCCGTGGTGGACCCAGATGCACCTCCGTCCCCTCCACTTGGCGCACCTGGACTCCCTCCAGCTGGCTCACCCCCAGACTCCCATGTGTTACTGGCAGCTCCTCCAGGACACCAGTTGCACCGGGCGCACTACGACCTGCGCCACACCTTCATGGGTGTGGTCTCATTGGGGTCACCCTCAGGAGAAGTGTCGCACCCCCGGAAAACACGCACAGTGGTGCAGCCTAGTGTTGGTGCTGCTGCTGGGCCAGTGGTTCCTCCATGTCCGGGGAGGATCAGACACTTCAAGGTCTAG
ORF Protein Sequence MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T97036-Ab Anti-FETUA/ C-peptide/ AHSG functional antibody
    Target Antigen GM-Tg-g-T97036-Ag C-peptide/AHSG protein
    ORF Viral Vector pGMPC001767 Human AHSG Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-T97036
    Target Name C-peptide
    Gene ID 197, 11625, 699348, 25373, 101099828, 607538, 280988, 100068067
    Gene Symbol and Synonyms A2HS,Aa2-066,AHS,AHSG,APMR1,BSP,FETUA,HSGA,pp63
    Uniprot Accession P02765
    Uniprot Entry Name FETUA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker
    Disease leukemia patients, Diabetic Nephropathy, Type 2 diabetes mellitus
    Gene Ensembl ENSG00000254647
    Target Classification Not Available

    The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.