Human ZDHHC7/DHHC7/SERZ-B ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_017740.3)

Cat. No.: pGMPC004875
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ZDHHC7/DHHC7/SERZ-B Non-Viral expression plasmid (overexpression vector) for mouse ZDHHC7 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ZDHHC7/DHHC7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC004875
Gene Name ZDHHC7
Accession Number NM_017740.3
Gene ID 55625
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 927 bp
Gene Alias DHHC7,SERZ-B,SERZ1,ZNF370
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xHA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCCATCAGGACACAGGCTCCGGGACGTCGAGCATCATCCTCTCCTGGCTGAAAATGACAACTATGACTCTTCATCGTCCTCCTCCTCCGAGGCTGACGTGGCTGACCGGGTCTGGTTCATCCGTGACGGCTGCGGCATGATCTGTGCTGTCATGACGTGGCTTCTGGTCGCCTATGCAGACTTCGTGGTGACTTTCGTCATGCTGCTGCCTTCCAAAGACTTCTGGTACTCTGTGGTCAACGGGGTCATCTTTAACTGCTTGGCCGTGCTTGCCCTGTCATCCCACCTGAGAACCATGCTCACCGACCCTGGGGCAGTACCCAAAGGAAACGCTACGAAAGAATACATGGAGAGCTTGCAGCTGAAGCCCGGGGAAGTCATCTACAAGTGCCCCAAGTGCTGCTGTATTAAACCCGAGCGCGCCCACCACTGCAGTATTTGCAAAAGATGTATTCGGAAAATGGATCATCACTGCCCGTGGGTGAACAATTGTGTAGGAGAAAAGAATCAAAGATTTTTTGTGCTCTTCACTATGTATATAGCTCTGTCTTCAGTCCATGCTCTGATCCTTTGTGGATTTCAGTTCATCTCCTGTGTCCGAGGGCAGTGGACTGAATGCAGTGATTTTTCACCTCCGATAACTGTAATCCTGTTGATCTTCCTGTGCCTTGAGGGTCTTCTGTTTTTCACTTTCACTGCAGTTATGTTTGGCACCCAAATCCACTCCATATGCAACGACGAGACGGAGATCGAGCGATTGAAAAGTGAGAAGCCCACATGGGAGCGGAGGCTGCGATGGGAAGGGATGAAGTCCGTCTTTGGGGGGCCCCCCTCACTCCTCTGGATGAATCCCTTTGTGGGCTTCCGATTTAGGCGACTGCCCACGAGACCCAGAAAAGGTGGCCCGGAGTTCTCAGTGTGA
ORF Protein Sequence MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2311-Ab Anti-ZDHHC7 monoclonal antibody
    Target Antigen GM-Tg-g-IP2311-Ag ZDHHC7 protein
    ORF Viral Vector pGMPC004875 Human ZDHHC7 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP2311
    Target Name ZDHHC7
    Gene ID 55625, 102193, 718634, 170906, 101083311, 489676, 617052, 100070274
    Gene Symbol and Synonyms DHHC7,Gramp2,Serz-1,SERZ-B,SERZ1,ZDHHC7,ZNF370
    Uniprot Accession Q9NXF8
    Uniprot Entry Name ZDHC7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000153786
    Target Classification Not Available

    Enables protein-cysteine S-palmitoyltransferase activity. Involved in several processes, including peptidyl-L-cysteine S-palmitoylation; polarized epithelial cell differentiation; and regulation of signal transduction. Located in Golgi apparatus and nucleoplasm. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.