Human TMEM72/C10orf127/KSP37 ORF/cDNA clone-Adenovirus particle (NM_001123376)

Cat. No.: vGMAD000763

Pre-made Human TMEM72/C10orf127/KSP37 Adenovirus for TMEM72 overexpression in-vitro and in-vivo. The TMEM72 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TMEM72-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TMEM72/C10orf127 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000763 Human TMEM72 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000763
Gene Name TMEM72
Accession Number NM_001123376
Gene ID 643236
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 828 bp
Gene Alias C10orf127,KSP37
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGCAGCTCCAGGTGTTCTGGACTGGGCTGGAATACACCTGCCGGCTCCTGGGCATCACCACTGCTGCAGTGTTGATCGGCGTGGGCACTGAGACCTTCCTCCAGGGCCAGTTCAAAAGCCTGGCTTTCTATCTGCTGTTTACAGGAGCCGCTGTCTCCATATGTGAAGGGGCCTACTTTGTGGCTCAGCTGCTGGCCATCTGCTTCCAGTGTCAACCAGGGTCCCTGGCAGACAGAGTAAGGGAGAAAGCCCACTGGCTGGGCTGCTTCCAGAAGTTCCTGGCCTACCTGCTGCTGTCGGTGGCCTGCTTCCTCCACCCGGTCCTGGTCTGGCACGTGACCATCCCAGGCTCCATGCTCATCATCACCGGCCTGGCCTACTTCCTTCTGAGCAAGCGGAAGAAGAGGAAAGCTGCCCCCGAGGTGCTGGCCTCCCCAGAGCAGTACACAGACCCCTCTAGCAGCGCTGTGAGCACCACCGGCTCTGGGGACACAGAGCAAACCTACACTTTCCATGGGGCCCTCAAGGAGGGGCCCAGCTCCCTTTTCATCCACATGAAGAGTATCCTGAAGGGGACTAAGAAGCCCAGTGCCCTCCAGCCCCCCAACACCCTGATGGAGCTGAGCCTGGAGCCAGCCGACTCCCTGGCCAAGAAGAAGCAGGTGCACTTTGAAGACAACTTGGTCCGCATAGTCCCCTCCCTCGCCGAAGGTCTGGATGATGGGGACAGTGAGCCAGAGGAGACCACCTCTGACACGACACCCATCATTCCCCCTCCCCAGGCCCCACTCTTCCTGTCATCTCTTACAGCCACCGGCCTGTTCTGA
ORF Protein Sequence MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2125-Ab Anti-TMEM72 monoclonal antibody
    Target Antigen GM-Tg-g-IP2125-Ag TMEM72 protein
    ORF Viral Vector pGMLV002478 Human TMEM72 Lentivirus plasmid
    ORF Viral Vector pGMAD000763 Human TMEM72 Adenovirus plasmid
    ORF Viral Vector vGMLV002478 Human TMEM72 Lentivirus particle
    ORF Viral Vector vGMAD000763 Human TMEM72 Adenovirus particle


    Target information

    Target ID GM-IP2125
    Target Name TMEM72
    Gene ID 643236, 319776, 718531, 362424, 101099248, 100684938, 513137, 100629248
    Gene Symbol and Synonyms C10orf127,C230095G01Rik,KSP37,RGD1308850,TMEM72
    Uniprot Accession A0PK05
    Uniprot Entry Name TMM72_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000187783
    Target Classification Not Available

    This gene encodes a transmembrane protein which may be expressed specifically in the kidney. [provided by RefSeq, Sep 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.