Human ESRRG/ERR-gamma/ERR3 ORF/cDNA clone-Adenovirus particle (NM_001438.4)

Cat. No.: vGMAD001665

Pre-made Human ESRRG/ERR-gamma/ERR3 Adenovirus for ESRRG overexpression in-vitro and in-vivo. The ESRRG adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ESRRG-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to ESRRG/ERR-gamma products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD001665 Human ESRRG Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD001665
Gene Name ESRRG
Accession Number NM_001438.4
Gene ID 2104
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1377 bp
Gene Alias ERR-gamma,ERR3,ERRg,ERRgamma,NR3B3
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGATTCGGTAGAACTTTGCCTTCCTGAATCTTTTTCCCTGCACTACGAGGAAGAGCTTCTCTGCAGAATGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTCAACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAGTTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCTCCTATCCTGGGAGGTAGTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGAATACATGCTCAACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCATCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGGCAATATAGAATACAGCTGCCCTGCCACGAATGAATGTGAAATCACAAAGCGCAGACGTAAATCCTGCCAGGCTTGCCGCTTCATGAAGTGTTTAAAAGTGGGCATGCTGAAAGAAGGGGTGCGTCTTGACAGAGTACGTGGAGGTCGGCAGAAGTACAAGCGCAGGATAGATGCGGAGAACAGCCCATACCTGAACCCTCAGCTGGTTCAGCCAGCCAAAAAGCCATATAACAAGATTGTCTCACATTTGTTGGTGGCTGAACCGGAGAAGATCTATGCCATGCCTGACCCTACTGTCCCCGACAGTGACATCAAAGCCCTCACTACACTGTGTGACTTGGCCGACCGAGAGTTGGTGGTTATCATTGGATGGGCGAAGCATATTCCAGGCTTCTCCACGCTGTCCCTGGCGGACCAGATGAGCCTTCTGCAGAGTGCTTGGATGGAAATTTTGATCCTTGGTGTCGTATACCGGTCTCTTTCGTTTGAGGATGAACTTGTCTATGCAGACGATTATATAATGGACGAAGACCAGTCCAAATTAGCAGGCCTTCTTGATCTAAATAATGCTATCCTGCAGCTGGTAAAGAAATACAAGAGCATGAAGCTGGAAAAAGAAGAATTTGTCACCCTCAAAGCTATAGCTCTTGCTAATTCAGACTCCATGCACATAGAAGATGTTGAAGCCGTTCAGAAGCTTCAGGATGTCTTACATGAAGCGCTGCAGGATTATGAAGCTGGCCAGCACATGGAAGACCCTCGTCGAGCTGGCAAGATGCTGATGACACTGCCACTCCTGAGGCAGACCTCTACCAAGGCCGTGCAGCATTTCTACAACATCAAACTAGAAGGCAAAGTCCCAATGCACAAACTTTTTTTGGAAATGTTGGAGGCCAAGGTCTGA
ORF Protein Sequence MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59875-Ab Anti-ESRRG monoclonal antibody
    Target Antigen GM-Tg-g-T59875-Ag ESRRG protein
    ORF Viral Vector pGMAD001665 Human ESRRG Adenovirus plasmid
    ORF Viral Vector pGMAAV002019 Human ESRRG Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC004822 Human ESRRG Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004894 Human ESRRG Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAD001665 Human ESRRG Adenovirus particle
    ORF Viral Vector vGMAAV002019 Human ESRRG Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T59875
    Target Name ESRRG
    Gene ID 2104, 26381, 106992350, 360896, 101091751, 478961, 536732, 100050530
    Gene Symbol and Synonyms ERR-gamma,ERR3,ERRg,ERRgamma,ESRRG,mKIAA0832,NR3B3
    Uniprot Accession P62508
    Uniprot Entry Name ERR3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000196482
    Target Classification Not Available

    This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.