Human SAA4/C-SAA/CSAA ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_006512.4)

Cat. No.: pGMAAV000264
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SAA4/C-SAA/CSAA Adeno-associated virus expression plasmid (ITR-vector) for SAA4 AAV packaging, SAA4 AAV production.The purified Human SAA4/C-SAA/CSAA AAV particle serves as an invaluable asset for in-depth in vivo SAA4 studies, mechanism of action (MOA) research, and the evolution of SAA4-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.


Target products collection

Go to SAA4/C-SAA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000264
Gene Name SAA4
Accession Number NM_006512.4
Gene ID 6291
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 393 bp
Gene Alias C-SAA,CSAA
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTTTTCACAGGCATTGTTTTCTGCTCCTTGGTCATGGGAGTCACCAGTGAAAGCTGGCGTTCGTTTTTCAAGGAGGCTCTCCAAGGGGTTGGGGACATGGGCAGAGCCTATTGGGACATAATGATATCCAATCACCAAAATTCAAACAGATATCTCTATGCTCGGGGAAACTATGATGCTGCCCAAAGAGGACCTGGGGGTGTCTGGGCTGCTAAACTCATCAGCCGTTCCAGGGTCTATCTTCAGGGATTAATAGACTGCTATTTATTTGGAAACAGCAGCACTGTATTGGAGGACTCGAAGTCCAACGAGAAAGCTGAGGAATGGGGCCGGAGTGGCAAAGACCCCGACCGCTTCAGACCTGACGGCCTGCCTAAGAAATACTGA
ORF Protein Sequence MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1259-Ab Anti-SAA4/ C-SAA/ CSAA functional antibody
    Target Antigen GM-Tg-g-SE1259-Ag SAA4 protein
    ORF Viral Vector pGMAAV000264 Human SAA4 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000264 Human SAA4 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE1259
    Target Name SAA4
    Gene ID 6291, 20211, 694709
    Gene Symbol and Synonyms C-SAA,CSAA,Saa-4,Saa-5,SAA4
    Uniprot Accession P35542
    Uniprot Entry Name SAA4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000148965
    Target Classification Not Available

    Predicted to be involved in acute-phase response. Located in extracellular exosome. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.