Human SAA4/C-SAA/CSAA ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_006512.4)
Cat. No.: pGMAAV000264
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SAA4/C-SAA/CSAA Adeno-associated virus expression plasmid (ITR-vector) for SAA4 AAV packaging, SAA4 AAV production.The purified Human SAA4/C-SAA/CSAA AAV particle serves as an invaluable asset for in-depth in vivo SAA4 studies, mechanism of action (MOA) research, and the evolution of SAA4-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
SAA4/C-SAA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000264 |
Gene Name | SAA4 |
Accession Number | NM_006512.4 |
Gene ID | 6291 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 393 bp |
Gene Alias | C-SAA,CSAA |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGGCTTTTCACAGGCATTGTTTTCTGCTCCTTGGTCATGGGAGTCACCAGTGAAAGCTGGCGTTCGTTTTTCAAGGAGGCTCTCCAAGGGGTTGGGGACATGGGCAGAGCCTATTGGGACATAATGATATCCAATCACCAAAATTCAAACAGATATCTCTATGCTCGGGGAAACTATGATGCTGCCCAAAGAGGACCTGGGGGTGTCTGGGCTGCTAAACTCATCAGCCGTTCCAGGGTCTATCTTCAGGGATTAATAGACTGCTATTTATTTGGAAACAGCAGCACTGTATTGGAGGACTCGAAGTCCAACGAGAAAGCTGAGGAATGGGGCCGGAGTGGCAAAGACCCCGACCGCTTCAGACCTGACGGCCTGCCTAAGAAATACTGA |
ORF Protein Sequence | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1259-Ab | Anti-SAA4/ C-SAA/ CSAA functional antibody |
Target Antigen | GM-Tg-g-SE1259-Ag | SAA4 protein |
ORF Viral Vector | pGMAAV000264 | Human SAA4 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMAAV000264 | Human SAA4 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-SE1259 |
Target Name | SAA4 |
Gene ID | 6291, 20211, 694709 |
Gene Symbol and Synonyms | C-SAA,CSAA,Saa-4,Saa-5,SAA4 |
Uniprot Accession | P35542 |
Uniprot Entry Name | SAA4_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000148965 |
Target Classification | Not Available |
Predicted to be involved in acute-phase response. Located in extracellular exosome. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.