Human APOA1/apo(a)/HPALP2 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000039.3)

Cat. No.: pGMAAV001259
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human APOA1/apo(a)/HPALP2 Adeno-associated virus expression plasmid (ITR-vector) for APOA1 AAV packaging, APOA1 AAV production.The purified Human APOA1/apo(a)/HPALP2 AAV particle serves as an invaluable asset for in-depth in vivo APOA1 studies, mechanism of action (MOA) research, and the evolution of APOA1-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to APOA1/apo(a) products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV001259
Gene Name APOA1
Accession Number NM_000039.3
Gene ID 335
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 804 bp
Gene Alias apo(a),HPALP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGCTGCGGTGCTGACCTTGGCCGTGCTCTTCCTGACGGGGAGCCAGGCTCGGCATTTCTGGCAGCAAGATGAACCCCCCCAGAGCCCCTGGGATCGAGTGAAGGACCTGGCCACTGTGTACGTGGATGTGCTCAAAGACAGCGGCAGAGACTATGTGTCCCAGTTTGAAGGCTCCGCCTTGGGAAAACAGCTAAACCTAAAGCTCCTTGACAACTGGGACAGCGTGACCTCCACCTTCAGCAAGCTGCGCGAACAGCTCGGCCCTGTGACCCAGGAGTTCTGGGATAACCTGGAAAAGGAGACAGAGGGCCTGAGGCAGGAGATGAGCAAGGATCTGGAGGAGGTGAAGGCCAAGGTGCAGCCCTACCTGGACGACTTCCAGAAGAAGTGGCAGGAGGAGATGGAGCTCTACCGCCAGAAGGTGGAGCCGCTGCGCGCAGAGCTCCAAGAGGGCGCGCGCCAGAAGCTGCACGAGCTGCAAGAGAAGCTGAGCCCACTGGGCGAGGAGATGCGCGACCGCGCGCGCGCCCATGTGGACGCGCTGCGCACGCATCTGGCCCCCTACAGCGACGAGCTGCGCCAGCGCTTGGCCGCGCGCCTTGAGGCTCTCAAGGAGAACGGCGGCGCCAGACTGGCCGAGTACCACGCCAAGGCCACCGAGCATCTGAGCACGCTCAGCGAGAAGGCCAAGCCCGCGCTCGAGGACCTCCGCCAAGGCCTGCTGCCCGTGCTGGAGAGCTTCAAGGTCAGCTTCCTGAGCGCTCTCGAGGAGTACACTAAGAAGCTCAACACCCAGTGA
ORF Protein Sequence MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T56545-Ab Anti-APOA1/ apo(a) monoclonal antibody
    Target Antigen GM-Tg-g-T56545-Ag APOA1 VLP (virus-like particle)
    ORF Viral Vector pGMAAV001259 Human APOA1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000043 Human APOA1 Adenovirus plasmid
    ORF Viral Vector pGMPC000928 Human APOA1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAAV001259 Human APOA1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000043 Human APOA1 Adenovirus particle


    Target information

    Target ID GM-T56545
    Target Name APOA1
    Gene ID 335, 11806, 696969, 25081, 101081076, 479427, 281631, 100062583
    Gene Symbol and Synonyms Alp-1,apo(a),apo-AI,Apoa-1,apoA-I,APOA1,Brp-14,HPALP2,Ltw-1,Lvtw-1,Sep-1,Sep-2,Sep2
    Uniprot Accession P02647
    Uniprot Entry Name APOA1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Ovary Cancer, Ovarian Cancer, ovarian cancer, Malignant neoplasm of bladder, Nephrotic syndrome, Nephrotic syndrome with focal and segmental glomerular lesions, Type 1 diabetes mellitus, Dent disease, Diabetic Nephropathy
    Gene Ensembl ENSG00000118137
    Target Classification Not Available

    This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.