Human FOSL2/FRA2 ORF/cDNA clone-Adenovirus plasmid (NM_005253)
Cat. No.: pGMAD000909
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FOSL2/FRA2 adenoviral expression plasmid for FOSL2 adenovirus packaging, FOSL2 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
FOSL2/FRA2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAD000909 |
Gene Name | FOSL2 |
Accession Number | NM_005253 |
Gene ID | 2355 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 981 bp |
Gene Alias | FRA2 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGTACCAGGATTATCCCGGGAACTTTGACACCTCGTCCCGGGGCAGCAGCGGCTCTCCTGCGCACGCCGAGTCCTACTCCAGCGGCGGCGGCGGCCAGCAGAAATTCCGGGTAGATATGCCTGGCTCAGGCAGTGCATTCATCCCCACCATCAACGCCATCACGACCAGCCAGGACCTGCAGTGGATGGTGCAGCCCACAGTGATCACCTCCATGTCCAACCCATACCCTCGCTCGCACCCCTACAGCCCCCTGCCGGGCCTGGCCTCTGTCCCTGGACACATGGCCCTCCCAAGACCTGGCGTGATCAAGACCATTGGCACCACCGTGGGCCGCAGGAGGAGAGATGAGCAGCTGTCTCCTGAAGAGGAGGAGAAGCGTCGCATCCGGCGGGAGAGGAACAAGCTGGCTGCAGCCAAGTGCCGGAACCGACGCCGGGAGCTGACAGAGAAGCTGCAGGCGGAGACAGAGGAGCTGGAGGAGGAGAAGTCAGGCCTGCAGAAGGAGATTGCTGAGCTGCAGAAGGAGAAGGAGAAGCTGGAGTTCATGTTGGTGGCTCACGGCCCAGTGTGCAAGATTAGCCCCGAGGAGCGCCGATCGCCCCCAGCCCCTGGGCTGCAGCCCATGCGCAGTGGGGGTGGCTCGGTGGGCGCTGTAGTGGTGAAACAGGAGCCCCTGGAAGAGGACAGCCCCTCGTCCTCGTCGGCGGGGCTGGACAAGGCCCAGCGCTCTGTCATCAAGCCCATCAGCATTGCTGGGGGCTTCTACGGTGAGGAGCCCCTGCACACCCCCATCGTGGTGACCTCCACACCTGCTGTCACTCCGGGCACCTCGAACCTCGTCTTCACCTATCCTAGCGTCCTGGAGCAGGAGTCACCCGCATCTCCCTCCGAATCCTGCTCCAAGGCTCACCGCAGAAGCAGTAGCAGCGGGGACCAATCATCAGACTCCTTGAACTCCCCCACTCTGCTGGCTCTGTAA |
ORF Protein Sequence | MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T32600-Ab | Anti-FOSL2 monoclonal antibody |
Target Antigen | GM-Tg-g-T32600-Ag | FOSL2 protein |
ORF Viral Vector | pGMLV002206 | Human FOSL2 Lentivirus plasmid |
ORF Viral Vector | pGMAD000909 | Human FOSL2 Adenovirus plasmid |
ORF Viral Vector | pGMPC001211 | Human FOSL2 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV002206 | Human FOSL2 Lentivirus particle |
ORF Viral Vector | vGMAD000909 | Human FOSL2 Adenovirus particle |
Target information
Target ID | GM-T32600 |
Target Name | FOSL2 |
Gene ID | 2355, 14284, 703068, 25446, 101093515, 608412, 509889, 100071081 |
Gene Symbol and Synonyms | FOSL2,Fra-2,FRA2 |
Uniprot Accession | P15408 |
Uniprot Entry Name | FOSL2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000075426 |
Target Classification | Tumor-associated antigen (TAA) |
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq, Jul 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.