Human FOSL2/FRA2 ORF/cDNA clone-Adenovirus particle (NM_005253)

Cat. No.: vGMAD000909

Pre-made Human FOSL2/FRA2 Adenovirus for FOSL2 overexpression in-vitro and in-vivo. The FOSL2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FOSL2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to FOSL2/FRA2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000909 Human FOSL2 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000909
Gene Name FOSL2
Accession Number NM_005253
Gene ID 2355
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 981 bp
Gene Alias FRA2
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGTACCAGGATTATCCCGGGAACTTTGACACCTCGTCCCGGGGCAGCAGCGGCTCTCCTGCGCACGCCGAGTCCTACTCCAGCGGCGGCGGCGGCCAGCAGAAATTCCGGGTAGATATGCCTGGCTCAGGCAGTGCATTCATCCCCACCATCAACGCCATCACGACCAGCCAGGACCTGCAGTGGATGGTGCAGCCCACAGTGATCACCTCCATGTCCAACCCATACCCTCGCTCGCACCCCTACAGCCCCCTGCCGGGCCTGGCCTCTGTCCCTGGACACATGGCCCTCCCAAGACCTGGCGTGATCAAGACCATTGGCACCACCGTGGGCCGCAGGAGGAGAGATGAGCAGCTGTCTCCTGAAGAGGAGGAGAAGCGTCGCATCCGGCGGGAGAGGAACAAGCTGGCTGCAGCCAAGTGCCGGAACCGACGCCGGGAGCTGACAGAGAAGCTGCAGGCGGAGACAGAGGAGCTGGAGGAGGAGAAGTCAGGCCTGCAGAAGGAGATTGCTGAGCTGCAGAAGGAGAAGGAGAAGCTGGAGTTCATGTTGGTGGCTCACGGCCCAGTGTGCAAGATTAGCCCCGAGGAGCGCCGATCGCCCCCAGCCCCTGGGCTGCAGCCCATGCGCAGTGGGGGTGGCTCGGTGGGCGCTGTAGTGGTGAAACAGGAGCCCCTGGAAGAGGACAGCCCCTCGTCCTCGTCGGCGGGGCTGGACAAGGCCCAGCGCTCTGTCATCAAGCCCATCAGCATTGCTGGGGGCTTCTACGGTGAGGAGCCCCTGCACACCCCCATCGTGGTGACCTCCACACCTGCTGTCACTCCGGGCACCTCGAACCTCGTCTTCACCTATCCTAGCGTCCTGGAGCAGGAGTCACCCGCATCTCCCTCCGAATCCTGCTCCAAGGCTCACCGCAGAAGCAGTAGCAGCGGGGACCAATCATCAGACTCCTTGAACTCCCCCACTCTGCTGGCTCTGTAA
ORF Protein Sequence MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T32600-Ab Anti-FOSL2 monoclonal antibody
    Target Antigen GM-Tg-g-T32600-Ag FOSL2 protein
    ORF Viral Vector pGMLV002206 Human FOSL2 Lentivirus plasmid
    ORF Viral Vector pGMAD000909 Human FOSL2 Adenovirus plasmid
    ORF Viral Vector pGMPC001211 Human FOSL2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV002206 Human FOSL2 Lentivirus particle
    ORF Viral Vector vGMAD000909 Human FOSL2 Adenovirus particle


    Target information

    Target ID GM-T32600
    Target Name FOSL2
    Gene ID 2355, 14284, 703068, 25446, 101093515, 608412, 509889, 100071081
    Gene Symbol and Synonyms FOSL2,Fra-2,FRA2
    Uniprot Accession P15408
    Uniprot Entry Name FOSL2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000075426
    Target Classification Tumor-associated antigen (TAA)

    The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq, Jul 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.