Human PEDS1/CarF/KUA ORF/cDNA clone-Adenovirus plasmid (NM_199129.4)

Cat. No.: pGMAD001648
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PEDS1/CarF/KUA adenoviral expression plasmid for PEDS1 adenovirus packaging, PEDS1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM189/PEDS1/CarF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001648
Gene Name PEDS1
Accession Number NM_199129.4
Gene ID 387521
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 813 bp
Gene Alias CarF,KUA,TMEM189
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCGGGCGCCGAGAACTGGCCGGGCCAGCAGCTGGAGCTGGACGAGGACGAGGCGTCTTGTTGCCGCTGGGGCGCGCAGCACGCCGGGGCCCGCGAGCTGGCTGCGCTCTACTCGCCAGGCAAGCGCCTCCAGGAGTGGTGCTCTGTGATCCTGTGCTTCAGCCTCATCGCCCACAACCTGGTCCATCTCCTGCTGCTGGCCCGCTGGGAGGACACACCCCTCGTCATACTCGGTGTTGTTGCAGGGGCTCTCATTGCTGACTTCTTGTCTGGCCTGGTACACTGGGGTGCTGACACATGGGGCTCTGTGGAGCTGCCCATTGTGGGGAAGGCTTTCATCCGACCCTTCCGGGAGCACCACATTGACCCGACAGCTATCACACGGCACGACTTCATCGAGACCAACGGGGACAACTGCCTGGTGACACTGCTGCCGCTGCTAAACATGGCCTACAAGTTCCGCACCCACAGCCCTGAAGCCCTGGAGCAGCTATACCCCTGGGAGTGCTTCGTCTTCTGCCTGATCATCTTCGGCACCTTCACCAACCAGATCCACAAGTGGTCGCACACGTACTTTGGGCTGCCACGCTGGGTCACCCTCCTGCAGGACTGGCATGTCATCCTGCCACGTAAACACCATCGCATCCACCACGTCTCACCCCACGAGACCTACTTCTGCATCACCACAGGCTGGCTCAACTACCCTCTGGAGAAGATAGGCTTCTGGCGACGCCTGGAGGACCTCATCCAGGGCCTGACGGGCGAGAAGCCTCGGGCAGATGACATGAAATGGGCCCAGAAGATCAAATAA
ORF Protein Sequence MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2029-Ab Anti-TMEM189 monoclonal antibody
    Target Antigen GM-Tg-g-IP2029-Ag TMEM189 protein
    ORF Viral Vector pGMLP005005 Human TMEM189 Lentivirus plasmid
    ORF Viral Vector pGMAD001648 Human PEDS1 Adenovirus plasmid
    ORF Viral Vector vGMLP005005 Human TMEM189 Lentivirus particle
    ORF Viral Vector vGMAD001648 Human PEDS1 Adenovirus particle


    Target information

    Target ID GM-IP2029
    Target Name TMEM189
    Gene ID 387521, 407243, 702250, 101081283, 507694
    Gene Symbol and Synonyms CarF,KUA,PEDS1,TMEM189
    Uniprot Accession A5PLL7
    Uniprot Entry Name PDES1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000240849
    Target Classification Not Available

    Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.