Human TMEM189/KUA ORF/cDNA clone-Lentivirus particle (NM_199129)

Cat. No.: vGMLP005005

Pre-made Human TMEM189/KUA Lentiviral expression plasmid for TMEM189 lentivirus packaging, TMEM189 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM189/KUA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005005 Human TMEM189 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005005
Gene Name TMEM189
Accession Number NM_199129
Gene ID 387521
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 813 bp
Gene Alias KUA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGGCGCCGAGAACTGGCCGGGCCAGCAGCTGGAGCTGGACGAGGACGAGGCGTCTTGTTGCCGCTGGGGCGCGCAGCACGCCGGGGCCCGCGAGCTGGCTGCGCTCTACTCGCCAGGCAAGCGCCTCCAGGAGTGGTGCTCTGTGATCCTGTGCTTCAGCCTCATCGCCCACAACCTGGTCCATCTCCTGCTGCTGGCCCGCTGGGAGGACACACCCCTCGTCATACTCGGTGTTGTTGCAGGGGCTCTCATTGCTGACTTCTTGTCTGGCCTGGTACACTGGGGTGCTGACACATGGGGCTCTGTGGAGCTGCCCATTGTGGGGAAGGCTTTCATCCGACCCTTCCGGGAGCACCACATTGACCCGACAGCTATCACACGGCACGACTTCATCGAGACCAACGGGGACAACTGCCTGGTGACACTGCTGCCGCTGCTAAACATGGCCTACAAGTTCCGCACCCACAGCCCTGAAGCCCTGGAGCAGCTATACCCCTGGGAGTGCTTCGTCTTCTGCCTGATCATCTTCGGCACCTTCACCAACCAGATCCACAAGTGGTCGCACACGTACTTTGGGCTGCCACGCTGGGTCACCCTCCTGCAGGACTGGCATGTCATCCTGCCACGTAAACACCATCGCATCCACCACGTCTCACCCCACGAGACCTACTTCTGCATCACCACAGGCTGGCTCAACTACCCTCTGGAGAAGATAGGCTTCTGGCGACGCCTGGAGGACCTCATCCAGGGCCTGACGGGCGAGAAGCCTCGGGCAGATGACATGAAATGGGCCCAGAAGATCAAATAA
ORF Protein Sequence MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2029-Ab Anti-TMEM189 monoclonal antibody
    Target Antigen GM-Tg-g-IP2029-Ag TMEM189 protein
    ORF Viral Vector pGMLP005005 Human TMEM189 Lentivirus plasmid
    ORF Viral Vector pGMAD001648 Human PEDS1 Adenovirus plasmid
    ORF Viral Vector vGMLP005005 Human TMEM189 Lentivirus particle
    ORF Viral Vector vGMAD001648 Human PEDS1 Adenovirus particle


    Target information

    Target ID GM-IP2029
    Target Name TMEM189
    Gene ID 387521, 407243, 702250, 101081283, 507694
    Gene Symbol and Synonyms CarF,KUA,PEDS1,TMEM189
    Uniprot Accession A5PLL7
    Uniprot Entry Name PDES1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000240849
    Target Classification Not Available

    Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.