Human IL20/IL-20/IL10D ORF/cDNA clone-Lentivirus plasmid (NM_018724)

Cat. No.: pGMLP-IL-027
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL20/IL-20/IL10D Lentiviral expression plasmid for IL20 lentivirus packaging, IL20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL20/IL-20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-IL-027
Gene Name IL20
Accession Number NM_018724
Gene ID 50604
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 531 bp
Gene Alias IL-20,IL10D,ZCYTO10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGCCTCTAGTCTTGCCTTCAGCCTTCTCTCTGCTGCGTTTTATCTCCTATGGACTCCTTCCACTGGACTGAAGACACTCAATTTGGGAAGCTGTGTGATCGCCACAAACCTTCAGGAAATACGAAATGGATTTTCTGAGATACGGGGCAGTGTGCAAGCCAAAGATGGAAACATTGACATCAGAATCTTAAGGAGGACTGAGTCTTTGCAAGACACAAAGCCTGCGAATCGATGCTGCCTCCTGCGCCATTTGCTAAGACTCTATCTGGACAGGGTATTTAAAAACTACCAGACCCCTGACCATTATACTCTCCGGAAGATCAGCAGCCTCGCCAATTCCTTTCTTACCATCAAGAAGGACCTCCGGCTCTGTCATGCCCACATGACATGCCATTGTGGGGAGGAAGCAATGAAGAAATACAGCCAGATTCTGAGTCACTTTGAAAAGCTGGAACCTCAGGCAGCAGTTGTGAAGGCTTTGGGGGAACTAGACATTCTTCTGCAATGGATGGAGGAGACAGAATAG
ORF Protein Sequence MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-217 Pre-Made Fletikumab biosimilar, Whole mAb, Anti-IL20 Antibody: Anti-IL-20/IL10D/ZCYTO10 therapeutic antibody
    Target Antibody GM-Tg-g-T94482-Ab Anti-IL20/ IL-20/ IL10D functional antibody
    Target Antigen GM-Tg-g-T94482-Ag IL20 protein
    Cytokine cks-Tg-g-GM-T94482 Interleukin 20 (IL20) protein & antibody
    ORF Viral Vector pGMLP-IL-027 Human IL20 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-110 Human IL20 Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-027 Human IL20 Lentivirus particle
    ORF Viral Vector vGMAP-IL-110 Human IL20 Adenovirus particle


    Target information

    Target ID GM-T94482
    Target Name IL20
    Gene ID 50604, 58181, 694689, 681112, 101096130, 609203, 515533, 100055632
    Gene Symbol and Synonyms If2d,IL-20,IL10D,IL20,ZCYTO10
    Uniprot Accession Q9NYY1
    Uniprot Entry Name IL20_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000162891
    Target Classification Not Available

    The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.