Human IL20/IL-20/IL10D ORF/cDNA clone-Adenovirus particle (NM_018724)
Cat. No.: vGMAP-IL-110
Pre-made Human IL20/IL-20/IL10D Adenovirus for IL20 overexpression in-vitro and in-vivo. The IL20 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL20-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
IL20/IL-20 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP-IL-110 | Human IL20 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP-IL-110 |
Gene Name | IL20 |
Accession Number | NM_018724 |
Gene ID | 50604 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 531 bp |
Gene Alias | IL-20,IL10D,ZCYTO10 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGAAAGCCTCTAGTCTTGCCTTCAGCCTTCTCTCTGCTGCGTTTTATCTCCTATGGACTCCTTCCACTGGACTGAAGACACTCAATTTGGGAAGCTGTGTGATCGCCACAAACCTTCAGGAAATACGAAATGGATTTTCTGAGATACGGGGCAGTGTGCAAGCCAAAGATGGAAACATTGACATCAGAATCTTAAGGAGGACTGAGTCTTTGCAAGACACAAAGCCTGCGAATCGATGCTGCCTCCTGCGCCATTTGCTAAGACTCTATCTGGACAGGGTATTTAAAAACTACCAGACCCCTGACCATTATACTCTCCGGAAGATCAGCAGCCTCGCCAATTCCTTTCTTACCATCAAGAAGGACCTCCGGCTCTGTCATGCCCACATGACATGCCATTGTGGGGAGGAAGCAATGAAGAAATACAGCCAGATTCTGAGTCACTTTGAAAAGCTGGAACCTCAGGCAGCAGTTGTGAAGGCTTTGGGGGAACTAGACATTCTTCTGCAATGGATGGAGGAGACAGAATAG |
ORF Protein Sequence | MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-217 | Pre-Made Fletikumab biosimilar, Whole mAb, Anti-IL20 Antibody: Anti-IL-20/IL10D/ZCYTO10 therapeutic antibody |
Target Antibody | GM-Tg-g-T94482-Ab | Anti-IL20/ IL-20/ IL10D functional antibody |
Target Antigen | GM-Tg-g-T94482-Ag | IL20 protein |
Cytokine | cks-Tg-g-GM-T94482 | Interleukin 20 (IL20) protein & antibody |
ORF Viral Vector | pGMLP-IL-027 | Human IL20 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-110 | Human IL20 Adenovirus plasmid |
ORF Viral Vector | vGMLP-IL-027 | Human IL20 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-110 | Human IL20 Adenovirus particle |
Target information
Target ID | GM-T94482 |
Target Name | IL20 |
Gene ID | 50604, 58181, 694689, 681112, 101096130, 609203, 515533, 100055632 |
Gene Symbol and Synonyms | If2d,IL-20,IL10D,IL20,ZCYTO10 |
Uniprot Accession | Q9NYY1 |
Uniprot Entry Name | IL20_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000162891 |
Target Classification | Not Available |
The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.