Human TOMM20/MAS20/MOM19 ORF/cDNA clone-Lentivirus plasmid (NM_014765)

Cat. No.: pGMLP-SPh-098
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TOMM20/MAS20/MOM19 Lentiviral expression plasmid for TOMM20 lentivirus packaging, TOMM20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TOMM20/MAS20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-SPh-098
Gene Name TOMM20
Accession Number NM_014765
Gene ID 9804
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 438 bp
Gene Alias MAS20,MOM19,TOM20
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGGTCGGAACAGCGCCATCGCCGCCGGTGTATGCGGGGCCCTTTTCATTGGGTACTGCATCTACTTCGACCGCAAAAGACGAAGTGACCCCAACTTCAAGAACAGGCTTCGAGAACGAAGAAAGAAACAGAAGCTTGCCAAGGAGAGAGCTGGGCTTTCCAAGTTACCTGACCTTAAAGATGCTGAAGCTGTTCAGAAGTTCTTCCTTGAAGAAATACAGCTTGGTGAAGAGTTACTAGCTCAAGGTGAATATGAGAAGGGCGTAGACCATCTGACAAATGCAATTGCTGTGTGTGGACAGCCACAGCAGTTACTGCAGGTCTTACAGCAAACTCTTCCACCACCAGTGTTCCAGATGCTTCTGACTAAGCTCCCAACAATTAGTCAGAGAATTGTAAGTGCTCAGAGCTTGGCTGAAGATGATGTGGAATGA
ORF Protein Sequence MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2158-Ab Anti-TOMM20 monoclonal antibody
    Target Antigen GM-Tg-g-IP2158-Ag TOMM20 protein
    ORF Viral Vector pGMLP000081 Human TOMM20 Lentivirus plasmid
    ORF Viral Vector pGMAD000693 Human TOMM20 Adenovirus plasmid
    ORF Viral Vector pGMAD000830 Human TOMM20 Adenovirus plasmid
    ORF Viral Vector pGMLP-atg-027 Human TOMM20 Lentivirus plasmid
    ORF Viral Vector pGMAP-atg-081 Human TOMM20 Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-098 Human TOMM20 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-238 Human TOMM20 Adenovirus plasmid
    ORF Viral Vector pGMPC001617 Human TOMM20 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000081 Human TOMM20 Lentivirus particle
    ORF Viral Vector vGMAD000693 Human TOMM20 Adenovirus particle
    ORF Viral Vector vGMAD000830 Human TOMM20 Adenovirus particle
    ORF Viral Vector vGMLP-atg-027 Human TOMM20 Lentivirus particle
    ORF Viral Vector vGMAP-atg-081 Human TOMM20 Adenovirus particle
    ORF Viral Vector vGMLP-SPh-098 Human TOMM20 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-238 Human TOMM20 Adenovirus particle


    Target information

    Target ID GM-IP2158
    Target Name TOMM20
    Gene ID 9804, 67952, 712039, 266601, 101082695, 100682999, 781575, 100058806
    Gene Symbol and Synonyms 1810060K07Rik,Gm19268,MAS20,mKIAA0016,MOM19,TOM20,TOMM20
    Uniprot Accession Q15388
    Uniprot Entry Name TOM20_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000173726
    Target Classification Not Available

    Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.