Human TOMM20/MAS20/MOM19 ORF/cDNA clone-Lentivirus plasmid (NM_014765)
Cat. No.: pGMLP-atg-027
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TOMM20/MAS20/MOM19 Lentiviral expression plasmid for TOMM20 lentivirus packaging, TOMM20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TOMM20/MAS20 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP-atg-027 |
Gene Name | TOMM20 |
Accession Number | NM_014765 |
Gene ID | 9804 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 438 bp |
Gene Alias | MAS20,MOM19,TOM20 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGTGGGTCGGAACAGCGCCATCGCCGCCGGTGTATGCGGGGCCCTTTTCATTGGGTACTGCATCTACTTCGACCGCAAAAGACGAAGTGACCCCAACTTCAAGAACAGGCTTCGAGAACGAAGAAAGAAACAGAAGCTTGCCAAGGAGAGAGCTGGGCTTTCCAAGTTACCTGACCTTAAAGATGCTGAAGCTGTTCAGAAGTTCTTCCTTGAAGAAATACAGCTTGGTGAAGAGTTACTAGCTCAAGGTGAATATGAGAAGGGCGTAGACCATCTGACAAATGCAATTGCTGTGTGTGGACAGCCACAGCAGTTACTGCAGGTCTTACAGCAAACTCTTCCACCACCAGTGTTCCAGATGCTTCTGACTAAGCTCCCAACAATTAGTCAGAGAATTGTAAGTGCTCAGAGCTTGGCTGAAGATGATGTGGAATGA |
ORF Protein Sequence | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2158-Ab | Anti-TOMM20 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2158-Ag | TOMM20 protein |
ORF Viral Vector | pGMLP000081 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAD000693 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMAD000830 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMLP-atg-027 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAP-atg-081 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-098 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-238 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMPC001617 | Human TOMM20 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000081 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAD000693 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMAD000830 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMLP-atg-027 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAP-atg-081 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-098 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-238 | Human TOMM20 Adenovirus particle |
Target information
Target ID | GM-IP2158 |
Target Name | TOMM20 |
Gene ID | 9804, 67952, 712039, 266601, 101082695, 100682999, 781575, 100058806 |
Gene Symbol and Synonyms | 1810060K07Rik,Gm19268,MAS20,mKIAA0016,MOM19,TOM20,TOMM20 |
Uniprot Accession | Q15388 |
Uniprot Entry Name | TOM20_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000173726 |
Target Classification | Not Available |
Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.