Human LY6G6D/C6orf23/G6D ORF/cDNA clone-Lentivirus plasmid (NM_021246)

Cat. No.: pGMLP000212
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LY6G6D/C6orf23/G6D Lentiviral expression plasmid for LY6G6D lentivirus packaging, LY6G6D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LY6G6D/C6orf23 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000212
Gene Name LY6G6D
Accession Number NM_021246
Gene ID 58530
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 402 bp
Gene Alias C6orf23,G6D,LY6-D,MEGT1,NG25
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAACCCCAGTTTGTTGGGATCTTGCTCAGCTCCCTGCTAGGGGCTGCCTTGGGAAACCGAATGCGGTGCTACAACTGTGGTGGAAGCCCCAGCAGTTCTTGCAAAGAGGCCGTGACCACCTGTGGCGAGGGCAGACCCCAGCCAGGCCTGGAACAGATCAAGCTACCTGGAAACCCCCCAGTGACCTTGATTCACCAACATCCAGCCTGCGTCGCAGCCCATCATTGCAATCAAGTGGAGACAGAGTCGGTGGGAGACGTGACTTATCCAGCCCACAGGGACTGCTACCTGGGAGACCTGTGCAACAGCGCCGTGGCAAGCCATGTGGCCCCTGCAGGCATTTTGGCTGCAGCAGCTACCGCCCTGACCTGTCTCTTGCCAGGACTGTGGAGCGGATAG
ORF Protein Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0778-Ab Anti-LY66D/ LY6G6D/ C6orf23 monoclonal antibody
    Target Antigen GM-Tg-g-MP0778-Ag LY6G6D VLP (virus-like particle)
    ORF Viral Vector pGMLP000212 Human LY6G6D Lentivirus plasmid
    ORF Viral Vector vGMLP000212 Human LY6G6D Lentivirus particle


    Target information

    Target ID GM-MP0778
    Target Name LY6G6D
    Gene ID 58530, 114654, 415062, 123385334, 102154694, 102147915
    Gene Symbol and Synonyms A930024F17Rik,C6orf23,G6D,G6f,g6f-ly6g6d,LY6-D,LY6G6D,MEGT1,NG25,NG32
    Uniprot Accession O95868
    Uniprot Entry Name LY66D_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000244355
    Target Classification Not Available

    LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM, Apr 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.