Human CLIC4/CLIC4L/H1 ORF/cDNA clone-Lentivirus plasmid (NM_013943)

Cat. No.: pGMLP000224
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLIC4/CLIC4L/H1 Lentiviral expression plasmid for CLIC4 lentivirus packaging, CLIC4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CLIC4/CLIC4L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $490.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000224
Gene Name CLIC4
Accession Number NM_013943
Gene ID 25932
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 762 bp
Gene Alias CLIC4L,H1,huH1,MTCLIC,p64H1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTGTCGATGCCGCTGAATGGGCTGAAGGAGGAGGACAAAGAGCCCCTCATCGAGCTCTTCGTCAAGGCTGGCAGTGATGGTGAAAGCATAGGAAACTGCCCCTTTTCCCAGAGGCTCTTCATGATTCTTTGGCTCAAAGGAGTTGTATTTAGTGTGACGACTGTTGACCTGAAAAGGAAGCCAGCAGACCTGCAGAACTTGGCTCCCGGGACCCACCCACCATTTATAACTTTCAACAGTGAAGTCAAAACGGATGTAAATAAGATTGAGGAATTTCTTGAAGAAGTCTTATGCCCTCCCAAGTACTTAAAGCTTTCACCAAAACACCCAGAATCAAATACTGCTGGAATGGACATCTTTGCCAAATTCTCTGCATATATCAAGAATTCAAGGCCAGAGGCTAATGAAGCACTGGAGAGGGGTCTCCTGAAAACCCTGCAGAAACTGGATGAATATCTGAATTCTCCTCTCCCTGATGAAATTGATGAAAATAGTATGGAGGACATAAAGTTTTCTACACGTAAATTTCTGGATGGCAATGAAATGACATTAGCTGATTGCAACCTGCTGCCCAAACTGCATATTGTCAAGGTGGTGGCCAAAAAATATCGCAACTTTGATATTCCAAAAGAAATGACTGGCATCTGGAGATACCTAACTAATGCATACAGTAGGGACGAGTTCACCAATACCTGTCCCAGTGATAAGGAGGTTGAAATAGCATATAGTGATGTAGCCAAAAGACTCACCAAGTAA
ORF Protein Sequence MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0303-Ab Anti-CLIC4/ CLIC4L/ H1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0303-Ag CLIC4 VLP (virus-like particle)
    ORF Viral Vector pGMLP000224 Human CLIC4 Lentivirus plasmid
    ORF Viral Vector vGMLP000224 Human CLIC4 Lentivirus particle


    Target information

    Target ID GM-MP0303
    Target Name CLIC4
    Gene ID 25932, 29876, 712337, 83718, 101098476, 487367, 286823, 100071457
    Gene Symbol and Synonyms CLIC4,CLIC4L,D0Jmb3,H1,huH1,mc3s5,MTCLIC,p64H1,TU-74
    Uniprot Accession Q9Y696
    Uniprot Entry Name CLIC4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000169504
    Target Classification Not Available

    Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.