Human EFNB1/CFND/CFNS ORF/cDNA clone-Lentivirus plasmid (NM_004429)

Cat. No.: pGMLP000308
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EFNB1/CFND/CFNS Lentiviral expression plasmid for EFNB1 lentivirus packaging, EFNB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to EFNB1/CFND products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $591.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000308
Gene Name EFNB1
Accession Number NM_004429
Gene ID 1947
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1041 bp
Gene Alias CFND,CFNS,EFB1,EFL3,Elk-L,EPLG2,LERK2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGGCCTGGGCAGCGTTGGCTCGGCAAGTGGCTTGTGGCGATGGTCGTGTGGGCGCTGTGCCGGCTCGCCACACCGCTGGCCAAGAACCTGGAGCCCGTATCCTGGAGCTCCCTCAACCCCAAGTTCCTGAGTGGGAAGGGCTTGGTGATCTATCCGAAAATTGGAGACAAGCTGGACATCATCTGCCCCCGAGCAGAAGCAGGGCGGCCCTATGAGTACTACAAGCTGTACCTGGTGCGGCCTGAGCAGGCAGCTGCCTGTAGCACAGTTCTCGACCCCAACGTGTTGGTCACCTGCAATAGGCCAGAGCAGGAAATACGCTTTACCATCAAGTTCCAGGAGTTCAGCCCCAACTACATGGGCCTGGAGTTCAAGAAGCACCATGATTACTACATTACCTCAACATCCAATGGAAGCCTGGAGGGGCTGGAAAACCGGGAGGGCGGTGTGTGCCGCACACGCACCATGAAGATCATCATGAAGGTTGGGCAAGATCCCAATGCTGTGACGCCTGAGCAGCTGACTACCAGCAGGCCCAGCAAGGAGGCAGACAACACTGTCAAGATGGCCACACAGGCCCCTGGTAGTCGGGGCTCCCTGGGTGACTCTGATGGCAAGCATGAGACTGTGAACCAGGAAGAGAAGAGTGGCCCAGGTGCAAGTGGGGGCAGCAGCGGGGACCCTGATGGCTTCTTCAACTCCAAGGTGGCATTGTTCGCGGCTGTCGGTGCCGGTTGCGTCATCTTCCTGCTCATCATCATCTTCCTGACGGTCCTACTACTGAAGCTACGCAAGCGGCACCGCAAGCACACACAGCAGCGGGCGGCTGCCCTCTCGCTCAGTACCCTGGCCAGTCCCAAGGGGGGCAGTGGCACAGCGGGCACCGAGCCCAGCGACATCATCATTCCCTTACGGACTACAGAGAACAACTACTGCCCCCACTATGAGAAGGTGAGTGGGGACTACGGGCACCCTGTCTACATCGTCCAAGAGATGCCGCCCCAGAGCCCGGCGAACATCTACTACAAGGTCTGA
ORF Protein Sequence MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0397-Ab Anti-EFNB1/ CFND/ CFNS monoclonal antibody
    Target Antigen GM-Tg-g-MP0397-Ag EFNB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000308 Human EFNB1 Lentivirus plasmid
    ORF Viral Vector pGMPC001536 Human EFNB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000308 Human EFNB1 Lentivirus particle


    Target information

    Target ID GM-MP0397
    Target Name EFNB1
    Gene ID 1947, 13641, 694149, 25186, 101082804, 607410, 534413, 100147489
    Gene Symbol and Synonyms Cek5-L,CFND,CFNS,EFB1,EFL-3,EFL3,EFNB1,Elk-L,Epl2,EPLG2,LERK-2,LERK2,Stra1
    Uniprot Accession P98172
    Uniprot Entry Name EFNB1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000090776
    Target Classification Not Available

    The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.