Human RGS10 ORF/cDNA clone-Lentivirus plasmid (NM_001005339)

Cat. No.: pGMLP000345
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RGS10/ Lentiviral expression plasmid for RGS10 lentivirus packaging, RGS10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RGS10/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $436.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000345
Gene Name RGS10
Accession Number NM_001005339
Gene ID 6001
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 546 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCAACCGCGCCGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCAGACATCCACGACAGCGATGGCAGTTCCAGCAGCAGCCACCAGAGCCTCAAGAGCACAGCCAAATGGGCGGCATCCCTGGAGAATCTGCTGGAAGACCCAGAAGGCGTGAAAAGATTTAGGGAATTTTTAAAAAAGGAATTCAGTGAAGAAAATGTTTTGTTTTGGCTAGCATGTGAAGATTTTAAGAAAATGCAAGATAAGACGCAGATGCAGGAAAAGGCAAAGGAGATCTACATGACCTTTCTGTCCAGCAAGGCCTCATCACAGGTCAACGTGGAGGGGCAGTCTCGGCTCAACGAGAAGATCCTGGAAGAACCGCACCCTCTGATGTTCCAGAAACTCCAGGACCAGATCTTTAATCTCATGAAGTACGACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTTTTAAAACACAAGCGAACCGAGGAAGAGGAAGAAGATTTGCCTGATGCTCAAACTGCAGCTAAAAGAGCTTCCAGAATTTATAACACATGA
ORF Protein Sequence MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2295-Ab Anti-RGS10 monoclonal antibody
    Target Antigen GM-Tg-g-MP2295-Ag RGS10 VLP (virus-like particle)
    ORF Viral Vector pGMLP000345 Human RGS10 Lentivirus plasmid
    ORF Viral Vector vGMLP000345 Human RGS10 Lentivirus particle


    Target information

    Target ID GM-MP2295
    Target Name RGS10
    Gene ID 6001, 67865, 703125, 54290, 101089300, 477840, 614550, 100065864
    Gene Symbol and Synonyms 2310010N19Rik,RGS10
    Uniprot Accession O43665
    Uniprot Entry Name RGS10_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000148908
    Target Classification Not Available

    Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.