Human ARL6IP5/addicsin/DERP11 ORF/cDNA clone-Lentivirus plasmid (NM_006407)

Cat. No.: pGMLP000353
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ARL6IP5/addicsin/DERP11 Lentiviral expression plasmid for ARL6IP5 lentivirus packaging, ARL6IP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ARL6IP5/addicsin products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000353
Gene Name ARL6IP5
Accession Number NM_006407
Gene ID 10550
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 567 bp
Gene Alias addicsin,DERP11,GTRAP3-18,hp22,HSPC127,jmx,JWA,PRAF3,Yip6b
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGTTAATATCGCCCCACTCCGCGCCTGGGACGATTTCTTCCCGGGTTCCGATCGCTTTGCCCGGCCGGACTTCAGGGACATTTCCAAATGGAACAACCGCGTAGTGAGCAACCTGCTCTATTACCAGACCAACTACCTGGTGGTGGCTGCCATGATGATTTCCATTGTGGGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCCCACAATAAAGACGTCCTTCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCCATGTTTGGAGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGACTTCGGAACCTCAAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAAGGCATCAACAGACTCACTGACTATATCAGCAAAGTGAAGGAATAA
ORF Protein Sequence MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0085-Ab Anti-PRAF3/ ARL6IP5/ DERP11 monoclonal antibody
    Target Antigen GM-Tg-g-MP0085-Ag ARL6IP5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000353 Human ARL6IP5 Lentivirus plasmid
    ORF Viral Vector vGMLP000353 Human ARL6IP5 Lentivirus particle


    Target information

    Target ID GM-MP0085
    Target Name ARL6IP5
    Gene ID 10550, 65106, 696360, 66028, 101090425, 476559, 509977, 100053342
    Gene Symbol and Synonyms 5930404D22Rik,addicsin,addiscin,Aip-5,ARL6IP5,DERP11,GTRAP3-18,hp22,HSPC127,jmx,JWA,PRAF3,Yip6b
    Uniprot Accession O75915
    Uniprot Entry Name PRAF3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000144746
    Target Classification Not Available

    Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.